KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0284041Help
Entry
DDB_G0284041      CDS       T00245                                 

Gene name
rcdII
Definition
(RefSeq) PH domain-containing protein
  KO
K09288  coiled-coil domain-containing protein 6
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF2046 APOBEC_C DUF3439 Med13_C
Motif
Other DBs
NCBI-GeneID: 8624395
NCBI-ProteinID: XP_638725
dictyBase: DDB_G0284041
UniProt: Q54Q72
LinkDB All DBs
Position
4
AA seq 464 aa AA seqDB search
MDSNAAEKSSKEIIEDLQRQLLTEKNRNRTLVEELKQLRDSHARIQIVTENEEEYITNKF
MKYLNQLKKEKEELALKVEQEEEYLTNTLQKKMLTIMKEKVDLENQLEQEEEFIVNKLQK
QIQDVMKDKKALEKRLENEINDHRSLLKLQDEVIVLRDKIKELESNGNKKEDIDALKAEN
FVLGQKIIREQEKLSKVNSENTKLMSNLEIDDERNFNNKSKRNRSISFPTSMASTTTTTT
TSITSSTTSITSSTSSINSSGSSSTNNTCNNNSSSNIPTSPLSCSSNSSGGGGGSGSLNN
SCNSNCSNSSNSSNNNCNNNNNNNNGNSKLSTGVPITRSRSSSSNSNPCLITKIVKEGWL
KRKSISSSNQETLEKRYYEISTDGEMREYFDETKQIPTSQYINLDTCFQIDIVTDNPNHP
GYSDIKLYIKTNSISPVEIITFSTSSNDCNDWKDTISSLMPLKR
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggacagtaatgcagcagagaaatcttcaaaagaaataattgaagatcttcaaagacag
ttattgacagaaaaaaatagaaatagaacattagtagaagaattaaaacaattaagagac
tcacatgcaagaattcaaatagtaacagagaatgaagaagagtatattactaataaattt
atgaaatatttgaatcaattgaaaaaagaaaaggaagaacttgccttaaaagtggaacaa
gaggaagaataccttacaaatactcttcaaaagaaaatgttaactattatgaaagaaaaa
gtcgatcttgaaaatcaattagaacaagaagaagaattcattgtaaataaattacaaaaa
caaattcaagatgtaatgaaagataaaaaagcattagaaaaaagattagaaaatgaaatt
aatgatcatagatcacttttgaaattacaagatgaggtaattgtattaagagataaaatc
aaagaacttgaatctaatggtaataaaaaagaagatattgatgcattaaaagctgaaaac
tttgtattaggtcaaaagattattagagaacaagaaaaactttcaaaagttaattcagaa
aatactaaattaatgtcaaatttagaaattgatgacgaaagaaattttaataataaatct
aaaagaaatagaagtatatcattcccaacatcaatggcatcaacaactactacaacaact
acatcaattacttcatcaaccacatcaattacttcatcgacttcatcaataaattcatca
ggttcatcttcaacaaacaatacatgtaataataatagtagtagtaatataccaacatca
ccattaagttgtagtagtaatagtagtggtggtggtggtggtagtggaagtttaaataat
agttgtaatagtaattgtagcaatagtagtaatagtagtaataacaattgcaacaacaac
aacaacaataataatggaaattcaaaattaagtacaggtgtaccaattacaagatcaaga
tcatcatcatcaaattcaaatccatgtttaattacaaagattgtcaaagaaggttggtta
aagagaaaatcaattagtagttcaaatcaagaaactttagaaaagagatattatgaaatc
tcaaccgatggtgaaatgagggaatatttcgatgaaactaaacaaattccaacttcacaa
tacataaacttagatacctgcttccaaattgatatcgtcactgataatccaaatcatcca
ggttattccgatataaaattatacatcaaaacaaattcaatctctcctgttgaaattatt
actttttcaacttcttcaaatgattgtaatgattggaaagatacaatttcatctttaatg
ccattaaaaagataa

KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_94376Help
Entry
DICPUDRAFT_94376  CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K09288  coiled-coil domain-containing protein 6
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF2046 PH MetW
Motif
Other DBs
NCBI-GeneID: 10501195
NCBI-ProteinID: XP_003287334
JGI: Dicpu1_94376
UniProt: F0ZIS8
LinkDB All DBs
Position
Unknown
AA seq 413 aa AA seqDB search
MDSSLADKSQGEIIEELQRQLVVEKNRNKTLTEEIKHLREQHARIQIVTENEEEYITNKF
MKYLNQLKKEKEELALKVEQEEEYLTNTLQKKMLAIMKEKVDLENQLEQEEEFIVNKLQK
QIQEVMKDKKVLEKRLENEINDHKYLLKLEDEVIELRDKIKELEKEQGEGIAKKEDIDAL
KAENFVLGQKIIREQEKLSKVNSENTRLMSNLEIDDERNFNKSKRNRSISFPNERLASSN
SSISSASSSSSSISSLANNINTSPTITTSSSCSSTCSSSNNSKIVVNSVPITRSRSSSSN
SNPCLVSKLLKEGWMKRKFPEGKLEKRFYEISTDGELKEYIDDAKQLLVQSIDLDTVSKV
DIVADPQHNGYSDLEIHISHSSKPEIVILSNYTEEINDWKLLISDLIPSPKHH
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggatagtagtttagcagataaatcacaaggtgaaattatagaagagcttcaaagacag
ttagtagttgaaaaaaatagaaataaaactttaactgaagagattaagcatcttagggaa
caacatgctagaattcaaattgttactgaaaatgaagaagaatatattacaaataaattt
atgaaatatttaaatcaattaaaaaaagaaaaagaagaacttgcccttaaagtagaacaa
gaagaagagtacctaaccaatacattacagaaaaaaatgttagcaataatgaaagaaaag
gtcgatcttgaaaatcaattagagcaagaggaggaatttattgttaataaattacaaaag
caaattcaagaagttatgaaagataaaaaggttttagaaaaaagattagaaaatgaaata
aatgatcataaatatttattaaagttagaagatgaagtgatcgaattaagagataaaatt
aaagaattggagaaagaacaaggtgaaggtattgcaaagaaagaggatattgatgcatta
aaagctgaaaactttgtacttggtcaaaaaattattagggaacaagaaaaactttcaaaa
gttaattctgaaaatactagattaatgtcaaatttagaaattgatgacgaaagaaacttt
aataaatctaaaagaaatagaagtatttcatttccaaatgaaagattagcatcttcaaac
tcatcaatatcatcagcatcatcatcttcttcatctatttcatctttagcaaacaatatt
aatacatcaccaactatcaccaccagcagtagttgcagcagcacatgcagcagtagtaat
aatagcaaaatagttgtaaactctgtaccaatcaccagatcaagatcatcatcatcaaat
tcaaatccatgcttagttagtaaactcttaaaggaaggttggatgaagagaaaattccca
gagggaaaattggaaaaaagattctatgaaatctcaactgatggtgaattaaaggaatat
atagacgatgccaaacaattattggtccaaagtattgatctcgatactgtatcaaaagtt
gatatcgttgccgatccacaacacaacggatatagcgatttagaaattcacatctctcat
agttcaaaaccagaaatagttatcctttcaaactatacagaagaaattaacgattggaaa
cttttaatttcagatttaataccatctccaaagcatcattag

DBGET integrated database retrieval system