KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0284667Help
Entry
DDB_G0284667      CDS       T00245                                 

Gene name
pigF
Definition
(RefSeq) phosphatidylinositol glycan, class F
  KO
K05287  GPI ethanolamine phosphate transferase 2/3 subunit F
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
ddi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    DDB_G0284667 (pigF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PIG-F
Motif
Other DBs
NCBI-GeneID: 8624716
NCBI-ProteinID: XP_638465
dictyBase: DDB_G0284667
UniProt: Q54PB0
LinkDB All DBs
Position
4
AA seq 219 aa AA seqDB search
MANLNQSSSSIQVPKLSKYMISFGYFLMGIIVTATMFLSNNNNFSIVSYTLLSEIIFGVI
ISFLHIGFSIFAFPGNSSTLDKINRSLIGLSIGNFVFYFLLILYGAPFLKSIHTTFFFGF
LLSSMCCLPPSILLGLNPQNWKDLFFTPNHNNIIDTCTTILVVFSILGAWIGAFPIPLDW
DRPWQQWPISCVFGSIVGHIFGLFICSVYSLVHKEKKSM
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatttaaatcaatcatcatcatcaatacaggttccgaaattatcgaaatatatg
atatcgtttggatattttttaatgggtattatagttacagcaacaatgtttttatcaaat
aataacaacttttcaattgtgtcatatactttattatcagaaataatatttggtgtgatt
atatcatttttgcatataggattttcaatattcgcatttcctggtaatagtagtacttta
gataaaataaatagatctttaattggactttcaattggtaattttgttttttatttcctt
ttaattttatatggtgctccatttttaaagtctattcatacaacattcttttttggattt
ttattatcttcaatgtgttgtttaccaccatcaattttattaggattaaatcctcaaaat
tggaaagatttattttttacaccaaaccataataatataattgatacatgtaccacaatt
ttagttgtttttagtattttaggtgcttggattggtgctttcccaattcctttagattgg
gatagaccttggcaacaatggccaattagttgtgtttttggttcaatagttggtcacata
tttggtttattcatttgttcagtttattctttagttcacaaagaaaagaagagcatgtaa

KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_83760Help
Entry
DICPUDRAFT_83760  CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K05287  GPI ethanolamine phosphate transferase 2/3 subunit F
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
dpp00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
dpp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpp00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    DICPUDRAFT_83760
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PIG-F
Motif
Other DBs
NCBI-GeneID: 10510813
NCBI-ProteinID: XP_003293185
JGI: Dicpu1_83760
UniProt: F1A0J2
LinkDB All DBs
Position
Unknown
AA seq 219 aa AA seqDB search
MANSIINSNSHSFTLSKNSRYSISTGYLVLGLIISILFIILNNSGLSIVEYPFINEILYG
TIIASTHLGFSLFAYPGNPSTKINRSIFGLLSGTLIFYIILILFGAPFLKSVHTTFFYGY
LLSAMCVVPPSILLGSNPQNWKELFLNQNHSNIIETCCVIVVVSSLLMSWVGAFPIPLDW
DRPWQVWPISCVYSSMFGHILGLFISTIYSLLYKEKKSK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggctaatagcataatcaatagtaatagccatagttttactttatctaaaaactcaaga
tattcaatttcaacaggataccttgtattgggattaattatttcgatattgtttattata
ttaaataacagtggactttcaattgtggaatatccttttataaatgaaatactgtatgga
acaattatagcatcaacacatttaggtttttcattatttgcatacccaggaaacccatca
accaaaattaatagatcgatttttggacttttatctggtactttaatattttatattata
ttaattttatttggtgcaccatttttaaaatcagttcatacaacatttttttatggatat
ttattatctgcaatgtgtgtggtgccaccatcaattttgttaggttccaatccacaaaat
tggaaagaactatttttaaatcaaaaccacagcaatataatcgaaacatgttgtgtaatt
gtagttgtatcaagtttactcatgtcatgggttggtgctttcccaattcctttagattgg
gatagaccatggcaggtttggccaattagttgcgtttattcttcaatgtttggccatata
ttgggtttatttatttcgacaatttattcattactatataaagaaaaaaaaagtaaataa

DBGET integrated database retrieval system