KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0284743Help
Entry
DDB_G0284743      CDS       T00245                                 

Gene name
4cl3
Definition
(RefSeq) 4-coumarate-CoA ligase
  KO
K01904  4-coumarate--CoA ligase [EC:6.2.1.12]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00130  Ubiquinone and other terpenoid-quinone biosynthesis
ddi01100  Metabolic pathways
ddi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    DDB_G0284743 (4cl3)
  09110 Biosynthesis of other secondary metabolites
   00999 Biosynthesis of secondary metabolites - unclassified
    DDB_G0284743 (4cl3)
Enzymes [BR:ddi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.12  4-coumarate---CoA ligase
     DDB_G0284743 (4cl3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 8624748
NCBI-ProteinID: XP_638379
dictyBase: DDB_G0284743
UniProt: Q54P79
LinkDB All DBs
Position
4
AA seq 551 aa AA seqDB search
MIRIINGQTYFTSKYPNIIIPEKPIPHLILKHIRYKPDQVLLVDGLTFKEYSSHFVADTI
EKVACGLNKLNIKKGDVLGVILPNLPEYVPIFHGTLLMGGITSLVNPDYTIEELSHTLAT
VSPRYLAVTLAVYEKIKNDLKRVFPSVEKVILVDIAGQTLKEIDQLTLSSDGIVMSFNQL
TNNNGKDYPIVRIDLTKDTAIIPFSSGTTGLFKGVCLSHYNLVSNTYQTQTIETSTYKKN
DSVIGVLPFFHSFGLMLHIMLMVKQGYRIVTLPKFEPVRFLELIKKYKVAMSFIVPPIAI
MFAKSPIVDKFDLSSLRTLFCGAAPLGSEIEDLIKERFKGRLVIKQGYGATELSPCCFVT
PNGLVKSGSSGTLLPNLLAKIISSETGENLGMGEKGEICIKGPNVMLGYYNNEKATNEVI
DKDGFLKTGDIGYVDEDGYFFIIDRSKELIKCKGFQVPPAELEALLLSHPKVADACVVGL
SKGDMGEVPRGFVVIKQNESLTEKELLDWAHPKIANYKHFRGGIFFIPAIPKSATGKLLR
KNLKDFNNLKL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgattagaataattaatggacaaacttatttcacatcaaaatacccaaatattataata
ccagagaaaccaataccacatttaattttaaaacatataagatataaacctgatcaagtt
ttattagttgatggtttaacttttaaagaatattcttcacattttgtcgctgatacaatt
gaaaaggttgcatgtggtttaaataaattaaatattaaaaaaggtgatgtacttggagta
attctaccaaatttaccagaatatgtaccaatatttcatggtacattattgatgggaggc
attacatcattagttaatccagactatacaattgaagagttatcacatacattagcaaca
gtttcaccaagatatttagcagtaacattagcagtatatgaaaagattaaaaatgattta
aaaagagtttttccaagtgttgaaaaagtgattttagtcgatattgcaggtcaaacttta
aaagaaattgatcaattaactttatctagtgatggaattgtaatgtcgtttaatcaatta
actaataataatggtaaagattacccaatcgttagaattgatctaacgaaagatacagct
attattccattttcaagtggcacaactggattatttaaaggtgtttgtttaagtcactat
aatctagtctcaaatacatatcaaactcaaaccattgaaacatcaacctataaaaagaat
gatagcgttattggtgtcttaccattctttcattcctttggtttaatgttacacataatg
ttgatggtgaaacaaggttatcgaattgttaccttaccaaaattcgaaccagttagattc
ttggaattaattaaaaagtataaggttgcaatgtcattcattgttccaccgattgctatc
atgtttgcaaaatcaccaatcgtcgataaatttgatctctcaagtttacgtacactattt
tgtggtgctgctccattaggttcagagattgaagatttaattaaagaaagattcaaaggc
agacttgtaattaaacaaggttatggtgctaccgaacttagtccatgttgttttgtaacc
ccaaatggattagttaaatcgggttcctctggtaccctcttacccaatctattagctaaa
atcatctcttcagagactggtgagaatttaggtatgggtgaaaagggtgaaatctgtatt
aaaggtccaaatgttatgttgggttattataacaatgaaaaggcaaccaatgaagtcata
gataaagatggattcttaaaaactggtgatattggttatgttgatgaagatggttatttc
tttatcatcgatagatcaaaggaattgatcaaatgtaaaggtttccaagtaccacctgct
gaattagaagcattactattatctcatccaaaagttgcagatgcctgtgtagtaggtctt
tcaaaaggtgatatgggtgaagtaccaagaggtttcgttgttattaaacaaaatgaatct
cttactgaaaaagaactcttggattgggctcacccaaaaattgcaaattataaacatttc
agaggtggtatctttttcatacctgcaattcctaaatctgcaactggtaaactattacgt
aaaaatcttaaagattttaataatctaaaattataa

DBGET integrated database retrieval system