KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0285461Help
Entry
DDB_G0285461      CDS       T00245                                 

Gene name
pigK
Definition
(RefSeq) phosphatidylinositol glycan, class K
  KO
K05290  GPI-anchor transamidase subunit K
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
ddi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    DDB_G0285461 (pigK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C13 Peptidase_C14 ArgoMid
Motif
Other DBs
NCBI-GeneID: 8625115
NCBI-ProteinID: XP_638069
dictyBase: DDB_G0285461
UniProt: Q54N74
LinkDB All DBs
Position
4
AA seq 446 aa AA seqDB search
MKKTTFRFYLVFLYAILVLYIGGIEDAISNGGAMGYEQPKTNFYNGGNGKADYNVEHFFR
GEHTNNWALLVCTSRFWFNYRHIANVLGFYRTVKKLGIPDSQIILMLADDMACNPRNSYA
GSIFNNENHKLNLYGDNIEVDYRGYEVNVENFIRVLTGRHEPEVARSKRLLTDDKSNILI
FLTGHGGDEFLKFQDNEEISSHDLADAFKQMWEKKRYHEILFMVDTCQANTLYTRFNSPN
ILAIGSSKFGENSYSHHSDPELGVAVIDRFTYYTLEFFESVDPHNVTLYQLFNTYSPQKL
QSHSEYRTDLFNRPLDQVPVTDFFGSVMRADLTPSTIVNEKQKDEKVEKDETTVNNNNNN
NNNDNVKKQTPKTKQISYRITEKPTSIQVQNNKDSELNLFNSKFITSALIFLVVFGLLSW
SSDFVKSNLILNTNDLKDLKSKSKQI
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacgacatttagattttatcttgtatttttatatgcaatattagttttatat
ataggtggtattgaagatgcaatttcaaatggtggggcgatgggatatgaacaaccaaaa
acaaacttttataatggtggtaatggtaaagcggattataatgttgaacattttttcaga
ggtgaacatacaaataattgggcacttttagtttgcacatcaagattttggtttaactat
agacatatagcaaatgtattaggtttttatagaactgttaagaaattaggtatacctgat
tcacaaattatattaatgttagcagatgatatggcatgtaatcctagaaattcatatgct
ggtagtatattcaataatgaaaatcataaattgaatttatatggtgataatattgaagtt
gactatagaggatatgaagttaatgttgaaaatttcattagagtgttaactggtagacat
gaaccagaggtagcacgttcaaagagattattgacagatgataaaagtaatattttaatt
ttcttaactggtcatggtggtgatgaatttttaaaatttcaagataatgaagagatttca
agtcatgatttagctgatgctttcaaacaaatgtgggaaaagaaaagatatcatgaaatt
ttattcatggttgatacttgtcaagctaatacattatatactcgttttaattctccaaat
attttagcaattggttcaagtaaatttggtgaaaatagttattctcatcattcagatcca
gaattaggggttgcagttattgatagatttacatattatacattggaattctttgaaagt
gttgacccacataatgtaacattatatcaattgttcaatacatatagtccacaaaaatta
caatcacatagtgaatataggacagatttattcaatagaccattagatcaagttcctgtt
acagacttttttggttctgtaatgagagctgatttaactccttcaacaattgtaaatgaa
aaacaaaaagatgaaaaagtagaaaaagatgaaactactgtaaataataataataataat
aataacaacgataatgtaaaaaaacaaacaccaaaaactaaacaaatttcatatagaatt
acagagaaaccaacatcaatccaagtacaaaataacaaagatagtgaattaaatcttttc
aattcaaaatttattacttcagctttaatatttttagtagtatttggattactttcttgg
tcttctgattttgtaaaatcaaatcttattttaaatacaaatgatttaaaagatctgaaa
tcaaaatcaaagcaaatttaa

KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_36512Help
Entry
DICPUDRAFT_36512  CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K05290  GPI-anchor transamidase subunit K
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
dpp00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
dpp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpp00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    DICPUDRAFT_36512
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C13 ArgoMid
Motif
Other DBs
NCBI-GeneID: 10504258
NCBI-ProteinID: XP_003289893
JGI: Dicpu1_36512
UniProt: F0ZR55
LinkDB All DBs
Position
Unknown
AA seq 436 aa AA seqDB search
MIKSNQNIFFIVFIYMFLILYISSIESAISGVKAQELPPKTTIHNINNSKGNYNVEHFFR
GEHTNNWALLVCTSRFWFNYRHIANVLGFYRTVKKLGIPDSQIILMLADDMACNPRNSYA
GSIFNNENHKLNLYGDNIEVDYRGYEVNVENFIRVLTGRHDPEVARSKRLLTDDKSNILI
FLTGHGGDEFLKFQDNEEISSHDLADAFKQMWEKKRYHEILFMVDTCQANTLYTRFNSPN
ILAIGSSKYGENSYSHHSDPELGVAVIDRFTYYTLEFFENVDPHNVTLQQLFNTYSPQKL
QSHSEYRTDLFNRPLDKVPVTDFFGSVMRADITPSMDQQQQKQQQEPNKIQPTKSKTISF
KPTEKPTKINNIDIKNTDIADKNLFSNSNFILSSIIFIGVFAFLAWSSEFAKSYLVFNPN
DILDSKNKENQKPKTK
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgataaaatctaatcagaatatattttttattgtatttatatatatgtttttgatacta
tatatttctagtatcgaaagtgcaatctccggagtcaaggcccaggaacttcctcccaaa
actaccatacataatattaataatagtaaaggaaattataatgtggaacatttctttaga
ggagaacatacaaacaactgggcactattagtttgtacatcgagattttggttcaactat
agacatatagctaatgttttaggtttttatagaactgtaaaaaaacttggtataccagat
tcacaaattattttaatgttagcagatgatatggcatgcaatccaagaaactcctacgct
ggaagtatttttaacaatgaaaatcataaattaaatctttatggagataatattgaagtt
gattacagaggttacgaagtcaatgtagaaaattttattagagttttgactggaagacat
gacccagaagtagccagatctaaaagacttttaacagatgataaaagtaatattttaatt
ttcttaactggtcatggcggtgatgaatttttaaagttccaagataatgaagaaatttca
agtcatgatttagcagatgctttcaaacaaatgtgggagaaaaaaagataccacgaaatt
ttatttatggtcgatacttgtcaagccaatacactatataccagatttaactcaccaaat
attcttgcaattggttctagcaaatatggtgaaaatagttattcacatcactcagatcca
gaacttggtgtagcagttattgatagatttacctattatactttagaattttttgaaaat
gtagatccacataatgtaacattacaacaattgtttaatacatatagcccacaaaaactt
caatcacatagcgaatatagaactgatttatttaatagaccattagacaaggtcccagtt
actgatttctttggttcagtaatgagagctgatataaccccctcaatggaccaacaacaa
caaaaacaacaacaagaaccaaataaaatacaaccaacaaaatcaaaaacaatttctttc
aaacctacagaaaaaccaacaaaaattaataatattgatattaaaaatacagatatagca
gataaaaaccttttcagtaattcaaattttattttatcttcaattatttttataggtgta
tttgcattcttggcttggtcatcagaatttgccaaaagctatttagtttttaatccaaat
gatattctagattcaaaaaataaagaaaatcaaaaaccaaaaacaaaataa

DBGET integrated database retrieval system