KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0285561
Entry
DDB_G0285561      CDS       T00245                                 
Symbol
rps15
Name
(RefSeq) 40S ribosomal protein S15
  KO
K02958  small subunit ribosomal protein S15e
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    DDB_G0285561 (rps15)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ddi03011]
    DDB_G0285561 (rps15)
Ribosome [BR:ddi03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    DDB_G0285561 (rps15)
SSDB
Motif
Pfam: Ribosomal_S19
Other DBs
NCBI-GeneID: 8625175
NCBI-ProteinID: XP_638126
dictyBase: DDB_G0285561
UniProt: Q54N17
LinkDB
Position
4:3385002..3385755
AA seq 144 aa
MSEQIKKRTFKKFTYSGVALESLLDLKEEQLISLLRCRARRKLRRETPIKHVNFLKKCRA
SKAAVTQVGEKPALVKTHARNILIVPEMIGSVIGIYNGKVFNQVEVKPEMIGHYTGEFSL
SYKSVNHGRPGIGATHSSRFIPLK
NT seq 435 nt   +upstreamnt  +downstreamnt
atgtctgaacaaatcaaaaagcgtactttcaaaaagttcacatactctggtgttgcctta
gagagtctccttgacttaaaggaagaacaattaatttcattattgagatgtcgtgctcgt
agaaagttaagacgtgaaaccccaatcaaacacgtcaacttcttaaagaaatgcagagcc
tcaaaagccgccgttacccaagtcggtgaaaaaccagccctcgtcaaaacccacgctcgt
aacattttaattgttccagaaatgatcggttctgtcattggtatctacaacggtaaagtt
ttcaatcaagttgaagttaaaccagaaatgattggtcactacactggtgaattctcactc
tcatacaagagtgtcaaccatggtcgtccaggtattggtgctactcactcttcaagattc
atcccattgaagtag

DBGET integrated database retrieval system