KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0285899Help
Entry
DDB_G0285899      CDS       T00245                                 

Definition
(RefSeq) alanine aminotransferase
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00220  Arginine biosynthesis
ddi00250  Alanine, aspartate and glutamate metabolism
ddi01100  Metabolic pathways
ddi01200  Carbon metabolism
ddi01210  2-Oxocarboxylic acid metabolism
ddi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DDB_G0285899
   00220 Arginine biosynthesis
    DDB_G0285899
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ddi01007]
    DDB_G0285899
Enzymes [BR:ddi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     DDB_G0285899
Amino acid related enzymes [BR:ddi01007]
 Aminotransferase (transaminase)
  Class I
   DDB_G0285899
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 8625344
NCBI-ProteinID: XP_637993
dictyBase: DDB_G0285899
UniProt: Q54MJ7
LinkDB All DBs
Position
4
AA seq 534 aa AA seqDB search
MFKRSLKVLLSNPPINRVKPSSTIIQPLSNTTTTTIINNNNITNFEKMTHKKSMTIDNIC
QNVRNAQYAVRGELVIRAEAISHQLQKQKTEGTKTLPFEEIVYCNIGNPQQLKQKPLTYF
RQVVSLVECPDLLDNPYVEKIYPADVISRAKEILGSINNTTGAYSNSQGIGLVLRSVADF
IERRDGHKSDPSEIFLTDGASVGVQRILKLLIKDRSDGILIPIPQYPLYSATIELYNGSQ
LGYLLNEEKGWSLEISQLEHSYNDAVSKGINPRALVIINPGNPTGQCLDRANMEEIVKFC
LEKNVVLLADEVYQENVYVKESKPFISFKKVVKDMGGDYADLEMVSFHSVSKGFVGECGK
RGGYMELNGVTQDVKAEIYKLASIGLCPNVIGQLVVDLMVRPPVAGEQSHDLYLKERDNI
YESLKKRANLLTNALNNLEGVTCNPSEGAMYAFPQIRLPAKAVEYANSIGKAPDAYYCIQ
LLEATGICVVPGSGFGQKDGTWHFRTTFLPSEEAIEGVCKRIADFHQSFMNKYK
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaaagaagtttaaaagttttattatcaaatccacccatcaacagagtaaagccc
tcttcaacaattattcaaccactttcaaatactactacaacaacaataattaataataat
aatataactaattttgaaaaaatgacacataaaaaatctatgacaattgataatatttgc
caaaatgtaagaaatgcacaatatgcagtacgtggtgaattagttattcgtgcagaagca
atttcacatcaattacaaaaacaaaaaacagaaggcacaaaaacattaccatttgaagag
attgtctattgtaatattggtaatccacaacaattgaaacaaaaaccattaacttatttc
cgtcaagttgtatcattagttgaatgtccagatttattagataatccatacgttgaaaag
atatatccagccgatgttatctcacgtgctaaagagatattaggatcaattaataataca
acaggtgcctattccaatagtcaaggtattggtttagttttaagatcagttgcagatttc
atagagagacgtgatggacataaatctgatccatccgaaattttccttacagatggtgca
tcagttggtgtacaacgtattttgaaacttttaattaaagatcgttcagacggtatctta
attccaattccacaatatccactctacagtgccaccattgaattatataatggcagtcaa
ttagggtacctattaaatgaagagaaaggttggtcactcgagatctcccaattggagcat
tcctacaatgatgcagtttcaaagggtattaatccacgtgcactcgttatcatcaatcca
ggtaatccaactggtcaatgtttagatagagcaaatatggaagagattgtcaagttttgt
ttagaaaagaatgtagtattattggctgatgaagtctatcaagagaatgtttatgtcaaa
gagagtaaaccattcatctcattcaaaaaggttgtcaaagatatgggtggtgattatgca
gatttagagatggtttcattccattcagttagtaaaggtttcgttggtgaatgtggtaaa
cgtggtggttatatggaattaaatggtgtcactcaagatgttaaagctgaaatttataaa
ctcgcatcaattggtttatgtccaaatgttattggtcaattggttgttgatttaatggtt
cgtccaccagttgctggtgaacaatcacatgatctctaccttaaagaaagagataatatc
tatgaatctttaaaaaaacgtgcaaatctcttaacaaatgctttaaataatcttgaaggt
gtaacttgtaatccatcagaaggtgcaatgtatgctttcccacaaattcgtcttccagct
aaagctgtagaatatgcaaattcaattggtaaagcaccagatgcttactattgtattcaa
ttactcgaagccactggtatctgtgttgtaccaggtagtggtttcggtcaaaaagatggt
acttggcattttagaactaccttcttaccttctgaagaagcaattgaaggtgtttgtaag
agaatcgctgatttccatcaatcatttatgaataaatataaataa

DBGET integrated database retrieval system