KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0285967Help
Entry
DDB_G0285967      CDS       T00245                                 

Definition
(RefSeq) C2 tensin-type domain-containing protein
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00562  Inositol phosphate metabolism
ddi01100  Metabolic pathways
ddi04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    DDB_G0285967
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    DDB_G0285967
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ddi01009]
    DDB_G0285967
Enzymes [BR:ddi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     DDB_G0285967
    3.1.3.48  protein-tyrosine-phosphatase
     DDB_G0285967
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     DDB_G0285967
Protein phosphatases and associated proteins [BR:ddi01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    DDB_G0285967
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LIM PTEN_C2 DSPc Y_phosphatase PTPlike_phytase Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 8625373
NCBI-ProteinID: XP_638022
dictyBase: DDB_G0285967
UniProt: Q54MG8
LinkDB All DBs
Position
4
AA seq 998 aa AA seqDB search
MDLVRKMVSKKKRRFEMYNFDLDLSYITDRVIAMGFPSESLEGLYRNRMRDVQRFFNTLH
ADHYKVYNLCSERKYEHCRFEDRVSEYPFDDHCPPTLNIISEFCNDMEMWLDQNPENVVA
VHCKAGKGRTGTMLACWLLYNKQCQTGSESMRLFANKRTHNSKGVTIPSQIRYVRYFEAL
LQYGKPIPKPPSITKVLSMIKMNSLPNFNIGGGCEPYLSIVQQGKSVFYSKPVKLKKGTI
HQQVELDCGNILLVNDVQIQFFNRNSKGHMFSYCFHTAFIEGTKIHIRRQEIDKAHKDLK
HFHSNFSIELIFLEDDRDDDSSSVSEESVEEKRVFNTSYATGLAKLYHNSNSNNKSLTSS
TSSTSNLSSSTNNTFEIISNNNNNNNNNNNNNNINSNNNKINDENSNKNNNNNNIINNNS
FSAWGNNSKIVKNRGSKLAFICPKCNLPITATDPSINRNSENYHWKCVVCVKCSKPLGGE
SDCVFENNEMLCTDCGTEFFKSCSGCNLVIKTSDFEELGDHIYHRSCFLCYYCTSYLGGK
DFIVENINNIRRFKCSSCIDNKNRQNGDDDDNNNNDNIENILENKIPEICDKLDKEIIKL
VIEIDKSTEPSPVSSIDPSMIFNDLEDNGKRRQMTVESMICSKCELAINQSRPIILDCGI
YHRECFQCSECFDETPMDPSLYYIRNDKPVCFDCDVNHIMNEAHSEITCYGCKLPIVDEV
MMDALNFKWHVACLVCSKCAIQIEGQLGDHQGLIYCKDHFEELVGTKCDQCNQYIDGMFL
KVNGKNLCPTCFRCFCCNEVLEGGKYFEKNGESICEKCRNEDILKRKTQIHIQHTLITSL
KNSQQISEKSSSSLSTSSTTTTTTTNNVVSSTSSTSTSPSTSPSNSPLSSSIQKDAPLFC
LNKSRSLFRNSIKIHLEDLKNSGERKTLLYPSFHRQMRKQTFKTAYPSLRGTRRKDFLNH
SKNELDSSNNSLSTLVNAFVPPQQSNNSNTTTTTNTST
NT seq 2997 nt NT seq  +upstreamnt  +downstreamnt
atggacttagtaagaaaaatggtatcaaaaaagaaaagacgttttgaaatgtataatttt
gatcttgatttatcatatatcacagacagagttatagcaatgggttttcctagtgaatca
ttggaaggattatataggaatagaatgagggatgtccaaagatttttcaatacattacat
gcagaccattataaagtttataatctttgttctgaaagaaaatatgaacattgcagattt
gaagatagagttagtgaatatccatttgatgatcattgtccaccaactttaaatataatt
tcagaattttgtaatgatatggagatgtggttggatcaaaatccagaaaatgtagttgca
gttcattgtaaagcaggtaaaggtagaactggtacaatgttagcatgttggctattatat
aataaacaatgtcaaactggatcagagtcaatgagattatttgcaaataaaagaacacac
aatagtaagggtgtaacaattccaagtcaaatcagatatgttagatatttcgaagcatta
ctacaatatggtaaaccaataccaaaaccaccatcaattacaaaagttttatcaatgata
aaaatgaattcattaccaaattttaatataggtggtggttgtgaaccatatttatcaatt
gttcaacaaggtaaatctgtattttattcaaaaccagttaaattaaaaaaaggaacaatt
catcaacaagttgaattagattgtggtaatattttattagttaatgatgttcaaattcaa
ttttttaatagaaattcaaagggtcatatgtttagttattgttttcatacagcatttatt
gaaggaactaaaattcatataagaagacaagaaattgataaagcacataaagatttaaaa
catttccatagtaatttttcaattgaattaatatttttagaggatgacagagatgatgac
tctagttcagtttcagaagaatctgttgaagaaaaaagagtattcaatacttcttatgca
actggtttagcaaaattatatcataatagtaatagtaataataaatcattaacatcatca
acatcatcaacttcaaatttatcatcaagtacaaataatacttttgaaatcatttcaaat
aataataataataataataataataataataataataatattaatagtaataataataaa
attaacgatgagaattcaaataaaaataataataataataacattattaataataacagt
ttttcagcttggggtaataatagtaaaattgttaaaaatagaggatctaaattagcattt
atttgtccaaaatgtaatcttcctataactgcaactgatccatcaattaatagaaattct
gaaaattatcattggaaatgtgtagtttgtgtaaaatgttcaaaaccattgggtggtgaa
agtgattgtgtatttgaaaataatgaaatgttatgtacagattgtggtactgaatttttt
aagagttgttcaggttgtaatttagttattaaaacatcagattttgaagaattgggtgac
catatttatcacagatcatgctttttatgttattattgcacaagttatttaggtggtaaa
gattttatagttgaaaatatcaataatattagaagatttaaatgttcaagttgtattgat
aataaaaatcgacaaaatggtgatgatgatgataataataataatgataatattgaaaat
attttggagaataaaataccagaaatttgtgataaattagataaagagattataaaatta
gttattgaaattgataaatcaacagaaccatcaccagtatcatcaattgatccatcaatg
atatttaatgatttagaagataatggaaaaaggcgacaaatgacagttgaatcaatgatt
tgtagtaaatgtgaattggcaattaatcaaagtagaccaattatattggattgtggtatt
tatcatagagaatgttttcaatgttcagaatgttttgatgaaaccccaatggatccatca
ttatattatattagaaacgataaaccggtttgctttgattgcgatgttaatcatataatg
aatgaagctcattctgaaatcacatgttatggttgtaaattaccaatagttgacgaagtt
atgatggatgcattgaattttaaatggcatgtagcttgtttggtttgttctaaatgtgct
attcaaatagagggtcaattgggtgaccatcaaggtctaatctattgtaaagatcatttc
gaagaattggtaggtaccaaatgtgaccaatgcaaccaatatatagatggcatgttttta
aaagttaatggtaaaaatttatgtccaacttgtttcagatgtttctgttgtaacgaggtt
ttagaaggtggtaaatattttgaaaagaatggtgaatcaatttgtgaaaaatgtagaaat
gaagatatcttaaaaagaaaaactcaaattcatattcaacatactttaattacatcttta
aaaaatagtcaacaaatttctgaaaaatcatcatcatcattatccacttcatcaacgact
actaccaccaccacaaataatgtagttagttcaacatcatcaacatcaacatcaccttca
acatcaccatcaaattcaccattatcatcatcaattcaaaaagatgcaccattgttttgt
ttaaataagagtagatcattatttagaaattcaattaaaattcatttagaggatttgaaa
aatagtggtgaacgtaaaactttactctatccttcatttcatcgtcaaatgagaaaacaa
acttttaaaactgcttatccatctttaagaggtacaagaagaaaagattttttaaatcat
tcaaaaaatgaattagattcatcaaataactctttatcaactttagttaatgcttttgta
ccaccacaacaatcaaataattcaaatacaacaactacaacaaatacttcaacttag

DBGET integrated database retrieval system