KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0286111Help
Entry
DDB_G0286111      CDS       T00245                                 

Gene name
pigW
Definition
(RefSeq) phosphatidylinositol glycan, class W
  KO
K05283  glucosaminylphosphatidylinositol acyltransferase [EC:2.3.-.-]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
ddi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    DDB_G0286111 (pigW)
Enzymes [BR:ddi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.-  Acyltransferases
    2.3.-.-  
     DDB_G0286111 (pigW)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GWT1 Dehydrin DUF872
Motif
Other DBs
NCBI-GeneID: 8625425
NCBI-ProteinID: XP_637914
dictyBase: DDB_G0286111
UniProt: Q54MC0
LinkDB All DBs
Position
4
AA seq 492 aa AA seqDB search
MDDQYKNDHQNFVSGNDGSTFFETCFILTLMPISVLFQRVVFATFFNNDKFPLPLALRFI
LEFFFIIVPFISAITFTELTPFLIVGMLITCLVVPMFAQKNVTIYFKNPKETLLNLNSMR
KGFLEEYRAFVMAATCICILAVDFQVFPRRLGKTETYGISLMDIGVGSVVLSGALVSRQS
RSSLIEKQQKKKREEEEDDNDKINKTSSSSSSSSSALKQQQQQVLSRSSLMWHQVKAQAP
LMILGFVRMILTKSINYQEHVSEYGLHWNFFFTLGFVSISLAFLKFNANISAILGVVLIC
VYQFLLNSFGLTDYILNHPRDNLISMNKEGICSFVGYLAIYLIGTKIGTELFKVRSSLTE
WRKFATKLLISSIVFYILWILCEIYIDKTSRRMANLGYVLAILSINLFNFSINILITLIT
GNHNASVIAKSINRNQLFIFLLGNILTGLINFSMKTIYAPVEQSMIIITSYTFALCLLAF
ILDYKNINIKFW
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggatgatcaatataaaaatgatcatcaaaattttgtttcaggtaatgatggatctacc
ttttttgaaacatgtttcattttaactttaatgccaatatctgtattatttcaaagagta
gtatttgcaacatttttcaacaatgacaaattcccattaccattggcactcagatttata
ttagaatttttttttattatagtaccatttatatcagcaatcacttttacagaattaaca
ccatttttaattgttggtatgcttattacatgtttagtagttccaatgtttgcacaaaaa
aatgttacaatttattttaaaaatccaaaagaaacattattaaatttaaattcaatgaga
aaaggatttcttgaagaatatagagcatttgtaatggcagcaacttgtatttgtatttta
gcagttgattttcaagttttcccaagaagattaggtaaaactgaaacttatggtatctca
ttaatggatattggcgttggttcagttgtattatcaggtgctttagtttcaagacaatca
agatcatctttaattgaaaaacaacaaaaaaagaaaagagaagaggaagaagacgataat
gataaaataaataaaacttcatcatcatcatcatcatcatcatccgctttaaaacaacaa
caacaacaagtattaagtagaagttcattaatgtggcatcaagttaaagcacaagcacca
ttaatgatattaggatttgttagaatgatattaacaaaatcaataaattatcaagaacat
gtttcagagtatggattacattggaatttcttttttacattaggttttgtttcaatctct
ttagcattcttaaaatttaatgcaaatatttcagcgattttaggtgtagtactcatttgt
gtatatcaattcctattgaatagttttggattaacagattatattctcaatcatccacgt
gataatttaatttcaatgaataaagaaggtatttgtagttttgttggttatttagcaatt
tatttaattggtactaaaatcggtacagaattatttaaagttagatcaagcttgacagaa
tggagaaaatttgcaactaaattattaatctcttcaattgttttctatattctttggatt
ttatgtgaaatctatattgacaaaacttcaagaagaatggcaaatttaggttatgtattg
gcaattctatcaataaatttattcaatttctcaataaatatactcattacattgatcact
ggtaatcataatgcatctgtaattgcaaaatcaatcaatcgtaatcaactattcatcttt
ttgttaggtaacatcttaactggtttaattaatttctcaatgaaaacaatttatgcacca
gttgaacaatcaatgattatcattacttcttatacttttgctttatgtttattagctttt
attttagattataaaaatattaatattaaattttggtaa

KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_45375Help
Entry
DICPUDRAFT_45375  CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K05283  glucosaminylphosphatidylinositol acyltransferase [EC:2.3.-.-]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
dpp00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
dpp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpp00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    DICPUDRAFT_45375
Enzymes [BR:dpp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.-  Acyltransferases
    2.3.-.-  
     DICPUDRAFT_45375
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GWT1 CrgA
Motif
Other DBs
NCBI-GeneID: 10510241
NCBI-ProteinID: XP_003284335
JGI: Dicpu1_45375
UniProt: F0ZA87
LinkDB All DBs
Position
Unknown
AA seq 479 aa AA seqDB search
MDQQYKIDHEKFVSNNEGSTFIETCFILTIMPISILFQRVVFAAFFHNDKYPLPMPIRFF
LEFLFIVVPFISAVTFTELTPFLIGGMLITCLVVPIFAHKNITIYFKNPKETLLNLNSMR
KGFIEEYRSFVMIATCICILAIDFPIFPRRLGKTETYGISLMDIGVGSVVLSGALVSRQS
RAGLIEKYQKAKKDDDKDKNSSSADNKNKIKLSRSSLMWHQVKAQAPLMILGFVRMILTK
SVNYQEHVSEYGLHWNFFFTLGFVSISLAFLKFNANISAILGVLFICIYQVFLNQFGLTD
YILNHPRDSLISMNKEGICSIIGYLSIHLIGTKIGCELFKVRNTLTEWRKFATKLLVLSV
ITWVLWLFCEIYIDRTSRRMANLGYVLAILAINLFNFSVNIFVYLISGNHNASVIAKSIN
RNQLFIFLLGNILTGLINFSMKTIYATQEESIAVITGYTFFLCLTAIILDYKNINIKFW
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggatcagcaatataaaattgatcacgaaaaatttgtatccaataatgaggggtcaaca
tttattgaaacatgctttattttaacaattatgccaatttctatattatttcaaagagta
gtttttgcagcattctttcataatgataaatatccattacctatgccaattagatttttt
ttagagtttttatttatagttgtaccatttatttcagcagttacctttacagaattaaca
ccatttttaattggtggtatgcttattacatgtttagtagtaccaatttttgcacataaa
aatataacaatttatttcaaaaacccaaaagaaacattattaaatctaaattcaatgaga
aaaggatttattgaagagtatagatcatttgttatgattgcaacttgtatttgtatattg
gcaattgattttccaatattcccaagacgtttaggtaaaacagaaacatatggtatttca
ttaatggatattggagttggttcagtagttttatcaggtgcattagtttcaagacaatct
agagcaggtctaattgaaaaatatcaaaaagctaaaaaagatgatgacaaagataaaaat
agttcaagcgctgataataaaaataaaattaaattatcaagaagttcattaatgtggcat
caagttaaagcacaagcaccattaatgattttaggttttgttagaatgattttaactaaa
tcggttaattatcaagaacatgtttcagaatatggattacattggaatttcttttttact
ttaggttttgtttcaatttcattagcatttttaaagtttaatgcaaatattagtgcaatt
ttaggtgtcttgtttatttgtatttatcaagttttcttaaatcaatttggattaacagat
tacattttaaatcatcctcgtgacagtttaatctcaatgaacaaagaaggtatttgtagc
ataattggatatttatcaattcatttaattggaactaaaattggttgtgaactattcaaa
gttagaaacacattgactgaatggagaaaatttgcaacaaaattattggtactctcagtt
atcacctgggtattatggctattttgtgaaatttatattgatagaacctcaagaagaatg
gcaaatttgggttatgttttagcaattctcgctatcaatcttttcaatttctctgtaaat
atttttgtctatctaatctctggtaatcataatgcttcagttatcgcaaaatcaattaac
cgtaatcaattatttatctttttattgggcaacattttaactggtcttatcaatttttca
atgaaaactatctatgccactcaagaggaatcaatagcagtaattacaggctacactttc
tttttatgccttactgccataattttagattataaaaatataaatattaaattttggtaa

DBGET integrated database retrieval system