KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0286353Help
Entry
DDB_G0286353      CDS       T00245                                 

Gene name
erkA
Definition
(RefSeq) ERK subfamily protein kinase
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    DDB_G0286353 (erkA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ddi01001]
    DDB_G0286353 (erkA)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ddi03036]
    DDB_G0286353 (erkA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ddi04147]
    DDB_G0286353 (erkA)
Enzymes [BR:ddi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     DDB_G0286353 (erkA)
Protein kinases [BR:ddi01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   DDB_G0286353 (erkA)
Chromosome and associated proteins [BR:ddi03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     DDB_G0286353 (erkA)
Exosome [BR:ddi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   DDB_G0286353 (erkA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Spore_coat_CotO SpoIIP Pex14_N DDHD Ndc1_Nup CCDC53 PepSY_TM Zip GREB1 RR_TM4-6 Mem_trans
Motif
Other DBs
NCBI-GeneID: 8625569
NCBI-ProteinID: XP_637704
dictyBase: DDB_G0286353
UniProt: P42525
LinkDB All DBs
Position
4
AA seq 529 aa AA seqDB search
MEPEFDHFQSQMDSDNTHQSTMFNVQDNNAILMSGMENVLQSPRQLQAAAQAQQQAAAQA
QQQQVQAQQVQAQQAQQQQQQQQNQQQQQQQQNQQNQQQQQNQQQQSQQMTQQQLQQLMP
PPPTSDTSNFNDNISYFVYGSQFTVPRRYSIVKCIGHGAYGVVCSAKDNLTGEKVAIKKI
SKAFDNLKDTKRTLREIHLLRHFKHENLISIKDILKPNSKEQFEDVYIVSELMDTDLHQI
ITSPQPLSDDHCQYFVYQMLRGLKHIHSANVLHRDLKPSNLLINEDCLLKICDLGLARVE
DATHQGFMTEYVATRWYRAPEVILSWNKYTKAIDIWSVGCIFAELLGRKPLFQGKDYIHQ
ITLIIETIGSPSEEDICNIANEQARQFIRNMGNQPKVNFANMFPKANPDAIDLLERMLYF
DPSKRLTVEEALAHPYFQSLHDPSDEPICLHKFSLNFEAWDLNRDLLKELIYNEMLAYHP
EDPQAPYYTDLNNPNFNLSRIQSSSELFNLLQQQKQQIHQQVNQQSIKN
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggaaccagaatttgatcactttcaatcacaaatggattccgataatacacaccaatca
acaatgtttaatgtccaagataataatgccattctaatgagtggaatggaaaatgttctc
caatctccacgtcaattacaagcagctgcacaagcacaacaacaagcagctgcacaagct
caacaacaacaagtacaagctcaacaagtacaagctcaacaagcacaacaacaacaacaa
caacaacaaaaccaacaacaacaacaacaacaacaaaaccaacaaaaccaacaacaacaa
caaaatcaacaacaacaatcacaacaaatgacacaacaacaattacaacaattaatgcca
ccaccaccaacaagtgatacaagtaattttaatgataatatatcatattttgtatatgga
tcacaatttacagtaccaagaagatattcaatagtaaagtgtataggacatggtgcctat
ggagttgtttgttctgccaaagataatttaacaggagaaaaggttgcaattaaaaagatt
agtaaagcatttgacaatttaaaagatacaaaacgtacattacgtgaaattcatttactt
agacattttaaacatgaaaatcttatctcgatcaaggatatattgaaaccaaatagtaaa
gagcaatttgaagacgtttatatagtttcagaattgatggatacagatttacaccaaatt
ataacttcaccacaaccattatcggatgatcattgtcaatatttcgtttatcaaatgtta
cgtggtctaaaacatattcattcagcaaatgtattacatagagatttaaaaccttcaaac
cttttaataaatgaagattgtctattaaaaatttgtgatcttggtcttgctcgtgttgaa
gatgcaactcatcaaggttttatgactgaatacgttgcaactcgttggtatcgtgctcct
gaagtcattctatcttggaataaatatacaaaagcaattgatatttggtctgtaggttgt
attttcgctgaacttttaggtagaaaacctttattccaaggaaaagattatattcatcaa
attacattaattatagaaactattggatcaccatcagaagaagatatttgtaatattgca
aatgaacaagcacgtcaatttataagaaatatgggtaaccaaccaaaagttaattttgca
aatatgttcccaaaagcaaatccagatgcaattgatttattagaaagaatgttatatttt
gatccaagtaagagattaacggttgaggaagctttggcacatccatattttcaatcttta
catgacccatcagatgaaccaatttgtttacataagtttagtttaaattttgaagcatgg
gatttaaatagagatttattaaaagaattaatttataatgaaatgttagcttatcatcct
gaagatccacaggcaccatactatactgacttaaataatcctaatttcaatttatcaaga
attcaatcttcaagtgaattatttaatttattacaacaacaaaaacaacaaatacatcaa
caagtaaatcaacaatcaattaaaaattaa

KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0280557Help
Entry
DDB_G0280557      CDS       T00245                                 

Definition
(RefSeq) protein kinase, CMGC group
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    DDB_G0280557
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ddi01001]
    DDB_G0280557
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ddi03036]
    DDB_G0280557
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ddi04147]
    DDB_G0280557
Enzymes [BR:ddi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     DDB_G0280557
Protein kinases [BR:ddi01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   DDB_G0280557
Chromosome and associated proteins [BR:ddi03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     DDB_G0280557
Exosome [BR:ddi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   DDB_G0280557
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like
Motif
Other DBs
NCBI-GeneID: 8622606
NCBI-ProteinID: XP_641048
dictyBase: DDB_G0280557
UniProt: Q54V83
LinkDB All DBs
Position
3
AA seq 460 aa AA seqDB search
MEINKIIEINNNNNNNNNKIIENNNDNKKIIEINNNNNDNNKIIEINDNNNNNIKDKILK
KENKDSILMKPPPIFITPANKDDTITVFHQGHIISIPRKLKINLKSITDCGPDGVMFRAK
NEDSKEEVIVKKISVFLMKDDKMARKLLRNLLFQRHFQQHPLVSTFQSVFKRKSSENYLI
SNKNNRNNVRLPLLQQKGDDDIYFEYLLPEFTLLQMIHNKLLTEYNIMIFLYQLLTVVKF
MHSAGVIHRDIDPSAITIDQNQCLKLTEFYFCFPSNCPVDLFFNDYDTSSFIYRAPETIW
RNTTYTTAIDVWNIGVIFGEMILGKRLFKTQDFEDHLISISKLIGNPTAEDLSIVLSKSI
FQYMEKIPKSTLTPSVGIKRRFKGASKDQIELLQGMLCWDPRKRMTIDQLLAHKYFSTIH
DESMQIKCNEIFNLKYYPDFYKMKSDLVKKSIENEFLTPC
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaataaaattattgaaattaataataataataataataataataataaaatt
attgaaaataataatgataataaaaaaattattgaaataaataataataataatgataat
aataaaattattgaaataaatgataataataataataatataaaagataaaattttaaaa
aaagaaaataaagactcaattttaatgaaaccaccaccaatattcattacaccagcaaat
aaagatgatactattactgtttttcatcaaggtcatattatatcaataccaagaaaattg
aaaattaatcttaaatcaattactgattgtggtcctgatggtgtaatgtttagagctaaa
aatgaagattctaaagaagaagttatcgtaaagaaaatatcggtattcttaatgaaggat
gataaaatggcaagaaaattattaagaaatttattattccaaagacattttcaacaacat
ccattggtatcaacattccaaagtgttttcaaaaggaaatcatctgaaaattatttaatt
tcaaataaaaacaatagaaataatgttagactacctttactacaacaaaagggtgatgat
gatatttattttgaatatcttttaccagagtttacattacttcaaatgattcataataaa
ctattaactgaatataatataatgattttcttatatcaattattaaccgtagttaaattc
atgcattccgctggtgtcatccatagagatatcgatccaagtgcaatcacaattgaccaa
aatcaatgtttgaaattaactgaattctatttttgctttccttcaaattgtccagttgat
ttatttttcaatgattatgatacaagttcatttatttatcgtgctcctgaaacaatttgg
agaaacacaacctatactactgccattgatgtttggaatattggtgtaattttcggtgaa
atgatattaggaaaaagactttttaaaacccaagattttgaagatcatttaatttcaatt
tcaaaattaattggtaatccaactgctgaagacctttcaatagttcttagtaaaagtatt
tttcaatatatggaaaaaattccaaaatcaactttaactccatcagttggaattaaaagg
agatttaaaggtgctagtaaagatcaaattgaattattacaaggtatgctatgttgggat
ccaagaaaaagaatgacaattgaccaattattagctcataaatatttttcaacaattcat
gatgaatcaatgcaaattaaatgtaatgaaatttttaatcttaaatattacccagatttt
tataagatgaaatcggatttagtaaaaaaatcaattgaaaatgaatttttaaccccatgc
tga

KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_53558Help
Entry
DICPUDRAFT_53558  CDS       T02090                                 

Definition
(RefSeq) extracellular signal-regulated protein kinase
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
dpp04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:dpp00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    DICPUDRAFT_53558
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dpp01001]
    DICPUDRAFT_53558
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dpp03036]
    DICPUDRAFT_53558
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dpp04147]
    DICPUDRAFT_53558
Enzymes [BR:dpp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     DICPUDRAFT_53558
Protein kinases [BR:dpp01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   DICPUDRAFT_53558
Chromosome and associated proteins [BR:dpp03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     DICPUDRAFT_53558
Exosome [BR:dpp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   DICPUDRAFT_53558
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Haspin_kinase APH RT_RNaseH_2
Motif
Other DBs
NCBI-GeneID: 10502884
NCBI-ProteinID: XP_003285440
JGI: Dicpu1_53558
UniProt: F0ZDG1
LinkDB All DBs
Position
Unknown
AA seq 409 aa AA seqDB search
MPPPPPINDSSNYNENISYFVYGSQFTVPRRYSIVKCIGHGAYGVVCSARDNLTGEKVAI
KKISKAFDNLKDTKRTLREIHLLRHFKHENLISVKDILKPNSKDTFDDVYLVSELMDTDL
HQIISSPQPLSDDHCQYFVYQMLRGLKHIHSANVLHRDLKPSNLLINEDCLLKICDLGLA
RVEDATHQGFMTEYVATRWYRAPEVILSWNKYTKAIDIWSVGCIFAELLGRKPLFQGKDY
IHQITLIIETIGSPSEEDISNIANEQARQFIRNMGYVPKVNFANLFPKANPDAINLLERM
LCFDPNKRLTVEDALSHPYFSTLHDPSDEPICLHKFNLSFESWDLNRELLKELIYNEMLY
YHPDPNDSTMVYTDLNNPAFNIQSFQNNSNDLFNLFQQQKFQLQQQIKN
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgccaccaccaccaccaataaatgattcaagtaattataatgaaaatatatcatatttt
gtatatggctcccaatttacagtaccaagaagatattcaattgtaaaatgtataggtcat
ggtgcatatggtgttgtatgttcagctagagacaatttaaccggtgaaaaagttgcaatt
aaaaaaattagtaaagcatttgacaatttaaaggataccaaacgaactctaagagaaatc
catcttttaagacactttaaacacgaaaatttaatatctgttaaagatatactgaaacca
aatagcaaggatacatttgatgatgtatatttggtttcagaattgatggataccgatctt
catcaaattatttcatctccacaacctttatcagatgatcactgccaatactttgtctac
caaatgttaagaggtcttaaacatattcactctgcaaatgtacttcatagagatttaaag
ccaagcaacctattaatcaacgaagattgtctcttaaagatttgtgatttgggtttagct
cgtgttgaagatgccactcaccaaggttttatgactgaatatgttgcaactcgttggtat
agagccccagaagtaattttatcctggaataaatatacaaaagctattgatatttggtct
gtcggttgtatttttgcagagctattaggtagaaaaccattattccaaggaaaagattat
attcatcaaattacattgattattgaaactattgggtcaccatcagaagaagatattagt
aatattgcaaatgagcaagcacgtcaattcattagaaatatgggctatgtgccaaaagtt
aattttgcaaatctattcccaaaagcaaaccccgatgctattaatctattagaaagaatg
ttatgctttgatccaaataaaagattaacagtagaagatgcattgtcacatccatatttt
tccacattacacgatccatccgatgaaccaatttgtttacataaattcaatttaagtttt
gaatcgtgggatttaaatagagaactcttaaaagaattaatatataacgaaatgttgtac
taccatccagatccaaatgatagcaccatggtttacaccgatttaaataatcctgccttt
aatattcaaagttttcaaaataatagcaatgacctttttaatttattccaacaacaaaaa
ttccaattacaacaacaaatcaaaaattaa

DBGET integrated database retrieval system