KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0287689Help
Entry
DDB_G0287689      CDS       T00245                                 

Gene name
tubA
Definition
(RefSeq) alpha tubulin
  KO
K07374  tubulin alpha
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi04145  Phagosome
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    DDB_G0287689 (tubA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ddi03019]
    DDB_G0287689 (tubA)
   03036 Chromosome and associated proteins [BR:ddi03036]
    DDB_G0287689 (tubA)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ddi04812]
    DDB_G0287689 (tubA)
   04147 Exosome [BR:ddi04147]
    DDB_G0287689 (tubA)
Messenger RNA biogenesis [BR:ddi03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     DDB_G0287689 (tubA)
Chromosome and associated proteins [BR:ddi03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     DDB_G0287689 (tubA)
Cytoskeleton proteins [BR:ddi04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    DDB_G0287689 (tubA)
Exosome [BR:ddi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   DDB_G0287689 (tubA)
  Exosomal proteins of other body fluids (saliva and urine)
   DDB_G0287689 (tubA)
  Exosomal proteins of colorectal cancer cells
   DDB_G0287689 (tubA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tubulin Tubulin_C Tubulin_3
Motif
Other DBs
NCBI-GeneID: 8626312
NCBI-ProteinID: XP_637058
dictyBase: DDB_G0287689
UniProt: P32255
LinkDB All DBs
Position
5
AA seq 457 aa AA seqDB search
MGREIISIHIGQAGVQVGNSCWELYCLEHGIERDGSIPADRKQSSDVNNLNKDLGTFFSE
STNGKKVVPRAIFLDLEPTVIDEIRTGDYKNLFHPEQLITGKEDAANNYARGHYTVGKEL
IDVCVDRIRRLADQCDGLQGFLVFHSVGGGTGSGFGSLLLQKLALDYGGKKSKLDFCVYP
SPQVSTSVVEPYNSVLSTHSLLEHTDVSFMLDNEAIYNICKNSLDIEKPTYTNLNRLIAQ
VISSLTSSLRFPGQLNLDINDIQTNLVPFPRLHFVLCSYAPVISREKAHHETITVDNITS
AVFSEKNIMAKCQPNLGKYMACCLMYRGDIVPKEAQKAVQNIRSEKSRNVSFVDWSPTGF
KCGINNQAPVSTKDSEMAEVKKSVCMLSNTTAISQVFSRINHKFDLMFVKRAFVHWYVGE
GMEEGEFAEARDDLLALEKDYESVSASTEGEEQEEEY
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgtgaaattatttcaattcatattggtcaagcaggtgtccaagtaggtaattca
tgttgggaactttactgtttagaacatggtatcgaacgtgatggttcaattccagctgat
cgtaaacaatcaagtgacgtcaacaacctcaacaaagatttaggtacattctttagcgaa
tcaaccaatggtaagaaagttgtcccaagagccatctttttagatttggaaccaaccgta
attgatgaaattagaactggtgattacaagaatctcttccatccagaacaactcattacc
ggtaaagaagatgctgccaacaattatgctcgtggtcactacaccgttggtaaagaatta
atcgatgtttgcgtcgatcgtatcagacgtttagccgatcaatgtgatggtctccaaggt
ttcctcgtcttccacagtgttggtggtggtacaggttctggtttcggttctttattactc
caaaaattagctctcgactatggtggtaaaaaatcaaaactcgatttctgtgtttaccca
tcaccacaagtttcaacctctgtcgttgaaccatacaattctgtactttcaactcattct
ttattagaacatactgatgttagttttatgttggataatgaagcaatttataatatttgt
aagaattcattagatattgaaaaaccaacttataccaatttgaatcgtttaattgctcaa
gttattagttcattaacttcatcactccgtttcccaggtcaattaaatcttgatatcaat
gatattcaaaccaatttagttccattcccacgtcttcactttgtactctgctcatatgca
ccagttatctcacgtgaaaaagctcaccacgaaaccatcactgtcgataacatcaccagt
gccgtcttctctgaaaagaacattatggccaaatgtcaaccaaatcttggtaaatatatg
gcctgttgtttaatgtacagaggtgatatcgtaccaaaagaagcccaaaaagccgttcaa
aacattcgttcagagaaatcaagaaacgtttcctttgtcgattggtccccaactggtttc
aaatgtggtatcaataatcaagctccagtttcaaccaaagatagtgaaatggctgaagtc
aagaagagcgtttgtatgttatcaaacaccaccgccatctctcaagtcttctcaagaatc
aaccacaaattcgatctcatgtttgtcaagagagctttcgtccattggtacgttggtgaa
ggtatggaggaaggtgagtttgctgaagctcgtgacgatttacttgctctcgaaaaagat
tatgaatctgtttctgcctcaactgaaggtgaagaacaagaagaagaatattaa

DBGET integrated database retrieval system