KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0288099
Entry
DDB_G0288099      CDS       T00245                                 

Name
(RefSeq) adenosine deaminase, tRNA-specific
  KO
K15441  tRNA-specific adenosine deaminase 2 [EC:3.5.4.-]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ddi03016]
    DDB_G0288099
Enzymes [BR:ddi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.-  
     DDB_G0288099
Transfer RNA biogenesis [BR:ddi03016]
 Eukaryotic type
  tRNA modification factors
   Deaminases
    DDB_G0288099
SSDB
Motif
Pfam: dCMP_cyt_deam_1 MafB19-deam Inv-AAD SNAD4 APOBEC1 DSPc
Other DBs
NCBI-GeneID: 8626460
NCBI-ProteinID: XP_636905
dictyBase: DDB_G0288099
UniProt: Q54JE5
LinkDB
Position
5:complement(1100340..1101531)
AA seq 254 aa
MDHLNNSSSCCNKIINESIEKETRKQYYIKTVEEFNETEIQEELSNHKKFMEAAIEEGYK
ALKEGEVPVACVIVYKGEIIARGSNKTNIKKNGTRHAELEAFDQIFLNKELNDRFKDSLL
EECDLYVTVEPCLMCSVALQFCKIKRVFFGCHNDKFGGNGSVYELNFSPISNGRPYNCIT
GLLKNQAILLLQLFYNQENKKAPIPNKRKRLDPEELKKEMLKITENSSSSQLILNITQDL
NSVKEKVLKDLNNK
NT seq 765 nt   +upstreamnt  +downstreamnt
atggatcatttaaacaatagcagtagctgttgtaataaaataataaatgaatcaattgaa
aaagaaacaaggaaacaatattatataaaaacagttgaagagtttaatgaaactgaaatt
caagaagaattatcaaaccataaaaaatttatggaagctgctattgaagagggttataaa
gcattaaaagagggagaagtaccagtggcatgtgttattgtatataaaggagaaattatc
gcaaggggttcaaataaaacaaatattaaaaaaaatggaacaagacacgcagaacttgaa
gcatttgatcagatatttctaaataaggaattaaatgatagatttaaagactcactttta
gaggaatgtgatttatatgtaacagtagagccatgtttgatgtgctccgtagctcttcaa
ttttgtaaaattaaaagagtattttttggttgccataatgataaatttggtggtaatggt
tcagtatatgaattaaatttttcaccaatttcaaatggtagaccatataattgtataaca
ggtttattaaaaaatcaagcaattctcttacttcaattattttataatcaagaaaataaa
aaagcaccaataccaaataaaagaaagagattagatccagaggaattaaaaaaagaaatg
ttaaaaattactgaaaattcatcatcaagtcaattaattttaaatataactcaagattta
aatagtgttaaagaaaaagttttaaaagatctaaacaataaataa

DBGET integrated database retrieval system