KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0289391
Entry
DDB_G0289391      CDS       T00245                                 

Symbol
pkiA
Name
(RefSeq) histidine triad family protein
  KO
K02503  histidine triad (HIT) family protein
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ddi04147]
    DDB_G0289391 (pkiA)
Exosome [BR:ddi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   DDB_G0289391 (pkiA)
SSDB
Motif
Pfam: HIT DcpS_C
Other DBs
NCBI-GeneID: 8627136
NCBI-ProteinID: XP_636246
dictyBase: DDB_G0289391
UniProt: Q23921
LinkDB
Position
5:2783089..2783551
AA seq 127 aa
MSESVGNIRIDPRDTIFAKIISGAIPSKKFYDDEYCIAIEDINPQAPVHLLVIPKLAVGG
LSDVANVDLEKYKESMGHIMSKIHHIASLKGADSYRLVINEGVLGQQSVRWLHIHILGGR
QMNWPPG
NT seq 384 nt   +upstreamnt  +downstreamnt
atgtcagaaagtgtagggaatataagaattgacccaagggatacaatatttgcaaaaatt
atttctggtgcaatcccatcaaaaaaattttacgatgatgaatattgtattgcaatcgaa
gatattaacccacaagcaccagtacatcttttagttattccaaaacttgccgttggtggt
cttagtgatgtcgccaatgttgaccttgaaaaatacaaagaatctatgggtcatatcatg
tcaaaaattcatcatatcgcttctcttaaaggtgctgattcttacagattggtcattaat
gaaggtgttttaggtcaacaatctgttagatggttacatattcatatccttggtggtaga
caaatgaattggccaccaggctaa

DBGET integrated database retrieval system