KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0289507Help
Entry
DDB_G0289507      CDS       T00245                                 

Gene name
act25
Definition
(RefSeq) hypothetical protein
  KO
K05692  actin beta/gamma 1
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi04145  Phagosome
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    DDB_G0289507 (act25)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ddi03021]
    DDB_G0289507 (act25)
   03019 Messenger RNA biogenesis [BR:ddi03019]
    DDB_G0289507 (act25)
   03036 Chromosome and associated proteins [BR:ddi03036]
    DDB_G0289507 (act25)
   03029 Mitochondrial biogenesis [BR:ddi03029]
    DDB_G0289507 (act25)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ddi04812]
    DDB_G0289507 (act25)
   04147 Exosome [BR:ddi04147]
    DDB_G0289507 (act25)
Transcription machinery [BR:ddi03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     DDB_G0289507 (act25)
Messenger RNA biogenesis [BR:ddi03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     DDB_G0289507 (act25)
Chromosome and associated proteins [BR:ddi03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     DDB_G0289507 (act25)
    NuA4 complex
     DDB_G0289507 (act25)
  Chromatin remodeling factors
   BAF complex
    DDB_G0289507 (act25)
   PBAF complex
    DDB_G0289507 (act25)
   SWR1 complex
    DDB_G0289507 (act25)
Mitochondrial biogenesis [BR:ddi03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    DDB_G0289507 (act25)
Cytoskeleton proteins [BR:ddi04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     DDB_G0289507 (act25)
Exosome [BR:ddi04147]
 Exosomal proteins
  Proteins found in most exosomes
   DDB_G0289507 (act25)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 8627175
NCBI-ProteinID: XP_636188
dictyBase: DDB_G0289507
UniProt: Q54HF0
LinkDB All DBs
Position
5
AA seq 385 aa AA seqDB search
MECEEVQAIVIDNGSSVCKAGFGGDDAPRTAFPSIVGRPRCTGFIVDMDKKDSYFCKKNS
CFMGQKDLYIGDEAQSKRGILNVKYPIERGIITNWNDMEEIWYHTFYNELHVAPEEHPVL
LTEPPLNPKANREKMTQIMFETFKTPAIYVANQGVLSLYSTGLTTGIVMNSGDGVSHTVP
VYEGYILRQAILSLDLAGRDLTDYMNELLTDRGYYFTTKGEKEIVRGIKEKLSYVALDFE
AEMQIASASPALEKSYELPDGQVITIGNERFRCPEALFRPYTGIHETIYNSIMKCDDDIR
KDLFGSVVLSGGSTMFPGIVDRMNKELTALAPSTMKIKIIAPPERKYSVWIGGSILASLS
SFQPRWISKEEYDESGPSIVHRKCF
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggaatgcgaagaagttcaagccatagttattgataatggttctagtgtgtgtaaagct
ggttttggtggtgatgatgctcctcgtacagctttcccatcaattgttggtcgtccaaga
tgtactggttttatagttgatatggataaaaaagattcatatttttgtaaaaagaattcg
tgttttatgggtcaaaaggatttatatattggtgatgaagctcaatcaaaaagaggtatt
ctaaatgttaaatatccaattgaacgtggtattattacaaattggaatgacatggaagaa
atctggtatcatactttttataatgaacttcatgttgctccagaggaacatccagttctc
ttaactgaaccaccattaaatccaaaagcaaatagagagaaaatgactcaaatcatgttt
gaaactttcaaaacccctgcaatatatgttgccaatcaaggtgtattatcattatattct
actggtcttacaactggtatcgttatgaattcgggtgatggtgtttctcatactgtgcca
gtttatgaaggttatattttacgtcaagcaattttaagtttagatttagctggtcgtgat
cttactgattacatgaatgaattattaactgatcgtggttactactttacaacaaagggt
gaaaaagaaatagttagaggtattaaagagaaattatcatatgttgcattagactttgaa
gctgaaatgcaaattgcctccgcatcgcctgcattagagaaatcatatgaattaccagac
ggtcaagttattacaattggtaatgaacgtttccgttgtccagaagcacttttccgacca
tatactggtattcatgaaacaatctataattcaatcatgaaatgtgatgatgatattcgt
aaagatttatttggtagtgttgtattatcaggtggttcaactatgtttccaggtattgta
gatcgtatgaataaagaattaactgcacttgcaccatcaacaatgaaaattaaaattatt
gcaccaccagaacgtaaatactctgtatggattggtggttcaattttagcctcactttca
agtttccaaccaaggtggatttcaaaagaagaatatgacgaatctggtccatcaattgtt
cacagaaaatgtttctaa

DBGET integrated database retrieval system