KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0289515Help
Entry
DDB_G0289515      CDS       T00245                                 

Gene name
pigS
Definition
(RefSeq) phosphatidylinositol glycan, class S
  KO
K05291  GPI-anchor transamidase subunit S
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
ddi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    DDB_G0289515 (pigS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PIG-S
Motif
Other DBs
NCBI-GeneID: 8627184
NCBI-ProteinID: XP_636197
dictyBase: DDB_G0289515
UniProt: Q54HE1
LinkDB All DBs
Position
5
AA seq 407 aa AA seqDB search
MFSKSKRVNIVITFVLLFIAGIPVWWNTTTTYRSNVDFTEINEYYNLKDNITQSKWPLFK
QLFNQVGPIQHDIEVKTATEYSLSFTLLNSDPSDIIPKWDFPYLSNKYIQPFIEQISDIA
NFTVQSKISHYATLLKSPLYDSKENSYYIPSAFLSEYINPNEWQLDTPSTNQPTLNFIIY
IPKTTQSPLYIRSNQNSNSFLIPQWGGIIIHNVNNNKNKNNNGPIDLTNELEDQMVSFKY
QLKELLGINNENNKNNNKNNEKKEKKYLEKDIILSNDEIDSTIKRYTAENINVSISTLYS
LSSLIESLPNMLVLDNIRDQVKVAIESLGRAHQCLEQSDYNCALQASKQSLASSESAFFD
KNMLSQLYFPDEHKYAVYTPLFVPVCFPIIAGIFQEFKHYRNKKLKK
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgtttagtaaaagtaaaagagttaatattgtaattacatttgtattattatttattgca
ggtataccggtttggtggaatactacaactacatatagatcaaatgtagattttacagaa
ataaatgaatattataatttaaaagataatatcacacaaagcaaatggccattatttaaa
caactctttaatcaagttggaccaattcaacatgatattgaagttaaaacagcaacagaa
tatagtttatcatttacattattaaattctgatccatctgatatcataccaaaatgggat
ttcccttacctttcaaataaatatattcaaccatttattgagcaaatatcagatattgca
aattttacagttcaatctaaaatttcacattatgcaacacttttaaaatcaccactttat
gattcaaaagagaatagttattatattccatctgcattcctttcagagtatatcaatcca
aatgaatggcaattagatactccatctacaaatcaaccaactttaaattttatcatatac
ataccaaaaacaactcaatcaccattatatattcgttcaaatcaaaatagtaattcattt
ttaattccacaatggggcggtattataattcataatgtaaataataataaaaataaaaat
aataatggtccaattgatttaacaaatgaattagaggatcaaatggtttcatttaaatat
caattaaaagaattattaggtatcaataatgaaaataataaaaacaacaacaaaaataat
gaaaaaaaagaaaagaaatatttagaaaaagatattattttaagtaatgatgaaattgat
tcaaccataaagagatatacagcagagaatatcaatgtatcaatatcaacattatatagt
ttaagttcattgattgaaagtttaccaaatatgttggttttggataatattcgtgatcaa
gtaaaagtagcaatcgaatctttaggtcgtgcacatcaatgtcttgaacaatctgattat
aattgtgcattacaagcatcaaagcaatcattagcctcttctgaatccgctttctttgat
aagaatatgctttctcaattatatttccctgatgaacataagtatgctgtttatactcca
ctattcgtaccagtttgtttcccaatcattgctggtatctttcaagaatttaaacattat
agaaataaaaaattaaaaaaataa

KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_54711Help
Entry
DICPUDRAFT_54711  CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K05291  GPI-anchor transamidase subunit S
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
dpp00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
dpp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpp00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    DICPUDRAFT_54711
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PIG-S
Motif
Other DBs
NCBI-GeneID: 10500908
NCBI-ProteinID: XP_003287188
JGI: Dicpu1_54711
UniProt: F0ZIE2
LinkDB All DBs
Position
Unknown
AA seq 397 aa AA seqDB search
MFSKSKRINIVFTFILLFISGIPIWWNTTTTYRSSVDFSLVNEYFNQNATTDKVLWPLFK
EFFNKVGKISHDIEVKSSTEYSLSFTLLNSDPIDIIPKWDFPYLSNKYIQPFIEQISDIA
NFTVQSKISHYATLLKSPLHEPKDNSYYIPSSFLSEYINPNEWQLDTPSTNQPTLNFIIY
IPSKSQSPLYIRSDQDSNSFLIPQWGGIIIHNTNTNKIKQGEIVDLTNEIENQMITFKYQ
LKELLGIKSNHEQQKSLSSDIILSDQEIDFAIKRYTAENINVTLSTLFSLSKLIDSLPNM
LVLDNIRDEVKVAIDALQQAHKCLQEKDYKGALKASKIALYSSESAFFDKNMLSQLYFPD
EHKYAVYTPLFVPVCFPIIAGVFQEFSNYRKKKLKKQ
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgttctcaaaaagtaaaagaataaatattgtctttacatttatattattatttatttcg
ggtattccaatatggtggaatacaacaaccacatatagatcatcagtagacttttcatta
gttaatgaatattttaatcaaaatgctacaacagataaagtattatggccattatttaaa
gaattttttaataaagttggaaagatttcacatgatatagaggttaaaagctcaactgaa
tatagtttatcattcacattattaaactctgatccaatagatataataccaaaatgggat
tttccatacctttcaaataaatatatacaaccattcatcgaacaaatttcagatatagca
aactttactgtacaatcaaaaatttcacattatgcaacacttttaaaatcaccacttcat
gaaccaaaagataatagttattatattccatcatcttttctatccgagtatattaatcca
aacgaatggcaattagatacaccttcaactaaccaacccactttaaattttatcatatat
ataccaagtaaatcacaatcaccattatatattcgttctgatcaagatagcaactcattt
ttaattccacaatggggtggtataataatacacaataccaataccaacaaaattaaacaa
ggtgaaattgtagatttaacaaatgaaattgaaaaccaaatgattactttcaaatatcaa
ttaaaagaattattaggtatcaaatcaaatcacgaacaacaaaaatcattatcatccgat
attattttaagtgatcaagaaattgattttgcaattaaaagatatactgccgaaaatatt
aatgttactctctcaactcttttcagtctcagcaaacttattgatagtcttccaaatatg
ttggtactcgataatattcgtgatgaagtaaaagttgccattgatgcattacaacaagct
cacaaatgtttacaagaaaaagattacaaaggtgccctaaaagcttcaaaaatcgcactc
tattcatccgaatctgcattctttgataaaaatatgctttcacaactttatttccccgat
gaacataaatatgccgtttatacaccattatttgtacctgtatgtttcccaattattgct
ggtgtattccaagagttttcaaactacaggaaaaagaaattaaaaaaacaataa

DBGET integrated database retrieval system