KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0290453Help
Entry
DDB_G0290453      CDS       T00245                                 

Gene name
usp12
Definition
(RefSeq) peptidase C19 family protein
  KO
K11842  ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ddi01002]
    DDB_G0290453 (usp12)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ddi04121]
    DDB_G0290453 (usp12)
Enzymes [BR:ddi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     DDB_G0290453 (usp12)
Peptidases and inhibitors [BR:ddi01002]
 Cysteine peptidases
  Family C19: ubiquitin-specific protease family
   DDB_G0290453 (usp12)
Ubiquitin system [BR:ddi04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    DDB_G0290453 (usp12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 HscB_4_cys
Motif
Other DBs
NCBI-GeneID: 8627653
NCBI-ProteinID: XP_635735
dictyBase: DDB_G0290453
UniProt: Q54G37
LinkDB All DBs
Position
5
AA seq 475 aa AA seqDB search
MGNNQTKSDLEKLYEKYPDFPKNQKLFGLENFGNTCYCNSVLQVLYFCVPFRNKILQYYC
ELKGLPPVVINNSNENNNNNNNNNNNSNNDTNNINNDSMNSNNNNSDNNNNNQNSNDSNN
SNSSSGSSGSSSTSYFKNMFNFFGISGSSVNNNNNTNNNNNNNNSYGQSSSFSSSYNNSR
NQEKEGNLIINLGELFYTIHQNKETHGCLKPETFVERLKKENELFSSFMHQDAHEFLNFL
LNSIAEFLQKQQKNKQPQQSSEKKECNKTLVHEIFEGTLTNETKCLTCESITNKDESFLD
LSIDIEQNKSLTNCLSNFSSIEILSKNDKFFCDQCNSLQEAQKRMKIKKLPNTLIIHLKR
FKYMENIQQYTKLNYRVVFPFEIIIQNTTSNIDEPDKKFNLFAVVIHVGSGPNHGHYYSL
IKCHGVWFVFDDHHIDIREESDIYDCFGSSNEFNNDCSYLLFYQCEDSSSNNKQK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgggaaataatcaaaccaaatctgatctggagaaattatatgaaaagtatccagatttt
ccaaaaaatcaaaaattatttggtcttgaaaattttggaaatacatgttattgtaattca
gttttacaggtattatatttttgtgtcccatttaggaataaaatactgcaatattattgt
gaattaaaaggattaccgccggtagtaataaataatagcaatgaaaataataataataat
aataataataataacaatagtaataatgataccaataatataaataatgattcaatgaat
agtaataataataatagtgataataataataataatcaaaatagtaatgatagtaataat
agcaatagtagtagtggtagtagtggtagtagtagcacatcatactttaaaaatatgttt
aacttttttggaatttcaggtagtagtgttaataataataataataccaataataataat
aataataataatagttatggacaatcatcatctttttcatcttcatacaataattctaga
aatcaagagaaagaaggaaatttaataataaatttaggagaattattttatacgattcat
caaaataaggaaactcatggttgtttaaaaccagagacatttgtagaaagattaaaaaaa
gagaatgaattatttagtagttttatgcatcaagatgctcacgaattcttaaacttttta
ttaaactcaattgcagaatttttacaaaaacaacaaaaaaataaacaacctcaacaatct
tctgaaaaaaaagaatgcaataaaacattagtacatgaaatttttgaaggtacattaaca
aatgaaacaaaatgtttaacatgtgaatcaattacgaataaggatgaatcatttttagat
ttatcaattgatattgaacaaaataaatcattgacaaattgtttatcaaatttcagttca
attgaaattttatcaaagaatgataaattcttttgtgatcaatgtaattcacttcaagaa
gctcaaaaaagaatgaaaattaaaaaattaccaaatacattaataattcatttaaagaga
tttaaatatatggaaaatattcaacaatatacaaaattaaattatagagtggtttttcct
tttgaaattattatccaaaatactacttcaaatattgatgaaccagataagaaattcaat
ttatttgccgttgtaattcatgttggaagtggtccaaatcatggtcattattatagttta
attaaatgtcatggagtttggtttgtttttgatgatcatcatattgatattagggaagaa
tcagatatatatgattgttttggttcctcaaatgaatttaataatgattgtagttatttg
ctattctaccaatgtgaagatagtagtagtaataataaacaaaaataa

DBGET integrated database retrieval system