KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0291490Help
Entry
DDB_G0291490      CDS       T00245                                 

Gene name
pigT
Definition
(RefSeq) hypothetical protein
  KO
K05292  GPI-anchor transamidase subunit T
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
ddi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    DDB_G0291490 (pigT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 8628196
NCBI-ProteinID: XP_001733046
dictyBase: DDB_G0291490
UniProt: B0G182
LinkDB All DBs
Position
6
AA seq 677 aa AA seqDB search
MGLKFLVVILILSIFVNSNEATKTTKNDDDNSSYATFNETQSFFEELLIKPLPKGKLMTH
VQFTTEWNSNFLEKSTFQHYDLFPRSIGDLITRVGIEEFTLVFTQGRWSYSEWGYPVRAA
PVGVELIAWMKPLEKGIDAQWRELTHSLSGLFCASMQFLYQVPHHTSSPNRSFRPEGESN
IYNYNGGDEDSFSSSSSSSSTTTTTTPAIKLNNGTIVPLELRYGILPRESVCTENLTPWV
KLLPCREQSGLGKLLNPHKLYDVHYHSMSITIRKICKNNNNNNNTDNDSSCLSPTLEIVQ
SLTIVNDLNNNQHQQETIETNLDNLFGLKGNTGLSACPLASRSKIYIQKQPSLNTNLKIT
NIGANSNNIEQQQQQQQSDSFKNGEKETDNFYIYDLMKYSTNKPLKLKMNWSKNFKRKFE
TPVVAHSHLTGYGQERGGIATQIFNTENYAINITYFQAIPWYLRLYFHTLKFNIETSGEK
SIDNTNRKEDSPFLLYKNISPAETRSSPSTIELSFEMPPNSVASMSIEFDKVFLHYTEHP
PDANRGFDLGSGVVTAFIKSSNANEGDAIHLEWSNETYNNNNNNNNNNNNNNRNNDKSSI
IPVRIYTEGLLITLPTPDFSMLYNVITLTGTVFALFFGSMINILIRRFKNTFTGNDFVSD
RPIAKIYRRILRFIDGK
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgggtttaaaatttttagtggttattttaatattatcaatatttgtaaatagtaatgaa
gccactaaaacaacaaaaaatgatgatgataactcatcatatgcaacattcaatgaaaca
caatcgtttttcgaagaacttttaattaaaccattaccaaagggtaaattaatgacacat
gtacaatttacaacagagtggaactcaaactttttagaaaaatcaacttttcaacattat
gatttatttccaagatcaattggtgatttaattactagagttggaattgaagaatttaca
ttagttttcacacaaggacgttggagttattcagaatggggttacccagttagagctgcc
cctgttggtgttgaattaatagcttggatgaaaccattagaaaaaggtattgatgcacaa
tggagagaattaactcattcattatcaggtttattttgcgctagtatgcaatttttatac
caagtaccacatcatacatcatcaccaaatagatcatttagaccagaaggtgaatctaat
atatataattacaatggtggtgatgaagatagtttttcatcatcatcatcatcatcatca
acaacaacaactacaacaccagctattaaattaaataatggtacaattgtaccattagaa
ttaagatatggtattttaccaagagaatcagtttgtacagagaatttaacaccatgggtt
aaattgttaccatgtcgtgaacaatctggtcttggtaaattacttaatccacataaacta
tatgatgtacattatcattcaatgtcaataacaattagaaagatttgtaaaaataataat
aataataataatactgataatgattcatcatgtttatcaccaacattagaaattgtacaa
agtttaacaattgtaaatgatttaaataataatcaacatcaacaagaaacaattgaaacc
aatttagataatttatttggacttaaaggtaatactggtttatcagcatgtccattagct
tctagaagtaaaatttatattcaaaaacaaccatctttaaatacaaatttaaaaattact
aatattggtgctaatagcaataatattgaacaacagcaacaacaacaacaaagtgatagt
tttaaaaatggtgaaaaagaaactgataatttttatatttacgatttaatgaaatattca
acaaataaaccattgaaattaaagatgaattggtcaaagaattttaagagaaagtttgaa
acaccagtggttgcacatagtcatttaactggctatggtcaagaacgtggtggtattgca
actcaaatatttaatactgaaaattatgcaatcaatataacttattttcaagctatacct
tggtatttaagattatattttcatactcttaaatttaatattgaaacaagtggtgaaaaa
tcaattgataacaccaatagaaaagaagattcaccatttttattatataaaaatatttca
ccagccgaaactagatcatcaccatcaactattgaattatcatttgaaatgccaccaaat
tctgtagcttcaatgtcaatagaattcgataaagtatttttacattatactgaacatcca
cccgatgcaaatagaggtttcgatttaggttctggtgttgtgactgctttcataaaatca
tcaaatgctaatgaaggtgatgcaattcatttagaatggtcaaatgaaacttataataat
aataataataataacaataataacaataataataataggaacaatgataaatcatcaata
atacctgttagaatttatacagaaggtttattaataacattaccaacaccagatttcagt
atgctttacaatgtaattacactcactggtactgttttcgctttgttttttggttcaatg
attaatattctcattagaagatttaaaaatacttttactggaaatgactttgtttctgat
cgtccaatcgcaaagatttatagaaggattttaagattcattgatggtaaataa

KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_29464Help
Entry
DICPUDRAFT_29464  CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K05292  GPI-anchor transamidase subunit T
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
dpp00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
dpp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpp00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    DICPUDRAFT_29464
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 10503044
NCBI-ProteinID: XP_003285524
JGI: Dicpu1_29464
UniProt: F0ZDP3
LinkDB All DBs
Position
Unknown
AA seq 1001 aa AA seqDB search
MGFKNLNIGSFVVIILIFSNILNINATKQNDHVNFEETQSFSEELIVKPLPKGKVMTHAQ
FTTEWNSNFLDKSTFQHYDLFPRSIGDLITRVGIEELTLVFTQGRWSYSDWGYPVRAAPV
GVELISWMKPLPEKGVDAQWKELTNSLSGLFCASMQFLYQVPHHTSFPSQSFRPEGSSNI
YYNGDMEQSRNSVPAIEITNPQNGTSKVVPLELRYGILPRESVCTENLTPWIKLLPCREQ
SGIGKLLAPNKLYDVHYHSMSITIRKICKNEDSECLAPTLEIVQSLTIVNDLNQQQEIVE
ISVDQLLGKKHQDSGLSACPLASTSKVYIQKQDNLETGLKVSPDPESQQSNQQYLVYDLK
KYKEPLKLKLNWYRNFDRSNKYPTPVVAHTHLTGYGQERGGISTQIFNNQNHPVNITYFQ
AIPWYLRLYFHTLKFNINNKEYADRDFLFKKISPAETRSSPSSIELSFEMPPNSVASFSV
DFDKVFLHYTEHPPDANRGFDLGSGVVTAYIDLEKNKNTPLKDDAINLEWSTETYQHKKQ
QSIVPIRIYTEGLLITLPTPDFSMLYNVITLTGTVFALFFGSMLNILIRRFKNTFTGNDF
VSDRPIAKIYRKILRFIDVLISSITLFDTHISDILSTHSPLLYKEYYSPIKTITLKKYKT
IEGIVKDNLEILSSPKPMYNNHSSLPYEGDFKILKTFDYTHKELNESQEITLNNLDKGEW
NFFQWGSYVGNQGSIKREKGFLRVNSNPYTDSLEHSFADHIKFLAVNGDSFTIPETGSLM
VNFSARGKTQNVDKHPFGNFVTDAQADYRLASSVLNVLDFKTSIISDFLITNKMVYALYE
RLSVSKQIYGDYATFIYTVPVLNVENDNSFQDLSIIYNKEKKTIEWHVNGKMVFMVDKVG
HFLSDKYKENLILYTGGQEQSVFPDAVNICFGSISLLDSTFISGKNRSGLVHLDNPETTK
YYNPLNINEELNFFNKDSNKSLLLFGQGNTIDIEKITILKK
NT seq 3006 nt NT seq  +upstreamnt  +downstreamnt
atgggttttaaaaatttgaatataggatcatttgttgtaataatattaatatttagtaat
atattgaatattaatgcaacaaaacaaaatgatcatgtaaattttgaagaaacacaatca
ttttctgaagaattaattgttaaacctcttccaaaaggaaaggtaatgacacatgcacaa
tttacaaccgaatggaattcaaattttttagataaatcaacttttcaacattatgactta
ttcccaagatcaattggagatttaataacaagagttggaattgaagagcttacattagta
tttactcaaggtagatggagttattcagattggggctatccagtaagagctgccccagtt
ggtgttgaattaatatcatggatgaaaccattaccagaaaaaggtgttgatgcacaatgg
aaagaattaacaaattcattatcaggtttattttgtgctagtatgcaatttttatatcaa
gtaccccatcatacttcattcccatcacaatcatttagaccagaaggttcatcaaatatt
tattataatggtgatatggaacaatctagaaatagtgtaccagcaattgaaattaccaat
ccacaaaatggcacaagcaaggttgtaccattggaattaagatatggtattttaccaaga
gaatcagtttgtacagagaatcttacaccttggattaaacttttaccatgccgtgaacaa
agtggaattggtaaacttttagcaccaaataaactctatgatgtccattatcattcaatg
tcaattacaattagaaagatttgtaaaaatgaagatagcgaatgtttagcaccaacttta
gagattgttcaatcattaaccatagtgaatgacttgaatcaacaacaagaaatagtagag
atttcagtcgatcaattacttggcaaaaaacatcaagatagcggtttatcagcatgtcct
ttagcatcaacaagtaaagtttatattcaaaaacaagataatttagaaacaggtttaaag
gtatcaccagatccagaatcgcaacaatccaatcaacaatatttagtttacgatcttaaa
aaatacaaagaaccattgaaattaaaattaaattggtacagaaatttcgatagatcaaat
aaatatccaacaccagtggttgcacatactcatttaacaggttatggccaagaaagaggt
ggtatttcaactcaaatttttaataatcaaaaccatcctgtcaatatcacctatttccaa
gccattccatggtatcttcgtttatatttccatactttaaaatttaatatcaacaacaag
gagtatgcagatcgtgacttcctctttaagaaaatttctccagctgaaacccgttcatca
ccatcatccatagagttgtcatttgaaatgcccccaaattcagtagcttcattctctgtc
gatttcgacaaagtatttttacactatacagagcatccacccgatgctaatagaggtttc
gatttaggctcaggtgtcgttacagcttatatagatttagagaaaaataaaaatacacca
ttaaaagacgatgctattaatttagaatggtcaacagagacttatcaacacaaaaaacaa
caaagcatagtaccaattagaatctataccgaaggtttattaatcactctcccaactcca
gatttcagtatgctttacaatgttatcaccctcactggcacagttttcgctcttttcttt
ggttcaatgttaaatatactcattagaagattcaaaaatacttttactggtaacgatttt
gtatccgaccgtcctattgcaaaaatatatagaaagattttaagatttattgatgtttta
atatcaagcataacactttttgatactcatataagtgatatactatccactcattcaccg
ttattatataaagaatattatagtcctattaaaacaataactttaaagaaatataaaaca
attgaaggtattgtaaaagataatttagaaatattatcatcaccaaaaccaatgtataat
aatcattcaagtttaccatacgaaggcgattttaaaattttaaaaactttcgattatact
cataaagaactaaatgaatcacaagagataacattaaataatttagataaaggagaatgg
aatttctttcaatggggctcctacgttggaaaccaaggttcaataaaaagagaaaaaggt
tttttaagagttaactctaatccatatactgatagtttagagcatagctttgcagaccac
atcaagtttttagctgttaatggtgattcattcactattcccgaaactggctccctaatg
gtaaacttttcagctagaggtaaaacacaaaacgttgataaacatccatttggaaacttt
gtaaccgatgcccaagctgactatagattagcaagcagcgtgctcaatgtattagacttc
aaaacaagtattatatccgatttccttattacaaataaaatggtttatgcactttacgaa
agattatcagtttcaaaacaaatttatggtgactatgctacatttatttatacagttcca
gtattaaatgtagaaaatgataactcattccaagatctatcaattatttataataaagaa
aagaaaactatcgaatggcatgtaaatggtaaaatggtatttatggtagataaagtcggt
catttcctttcagataaatataaagaaaatttaatcctctacacaggtggtcaagagcaa
tcagtattcccagatgccgtaaatatatgttttggttcaatttcattattggattcaact
tttatttcaggtaaaaacagatcaggcttagttcatctcgataatcccgaaactacaaaa
tattataacccattaaatattaatgaggaattaaatttctttaataaggattcaaataaa
tctttattactttttggtcaaggtaataccattgatattgaaaaaattacaatcttaaaa
aaataa

DBGET integrated database retrieval system