KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0293434Help
Entry
DDB_G0293434      CDS       T00245                                 

Gene name
rasG
Definition
(RefSeq) Ras GTPase
  KO
K07827  GTPase KRas
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    DDB_G0293434 (rasG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ddi04131]
    DDB_G0293434 (rasG)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:ddi04031]
    DDB_G0293434 (rasG)
Membrane trafficking [BR:ddi04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    DDB_G0293434 (rasG)
GTP-binding proteins [BR:ddi04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    DDB_G0293434 (rasG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 Septin
Motif
Other DBs
NCBI-GeneID: 8629223
NCBI-ProteinID: XP_629133
dictyBase: DDB_G0293434
UniProt: P15064
LinkDB All DBs
Position
6
AA seq 189 aa AA seqDB search
MTEYKLVIVGGGGVGKSALTIQLIQNHFIDEYDPTIEDSYRKQVTIDEETCLLDILDTAG
QEEYSAMRDQYMRTGQGFLCVYSITSRSSFDEIASFREQILRVKDKDRVPMIVVGNKCDL
ESDRQVTTGEGQDLAKSFGSPFLETSAKIRVNVEEAFYSLVREIRKDLKGDSKPEKGKKK
RPLKACTLL
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgacagaatacaaattagttattgttggtggtggtggtgtcggtaaaagtgccttaacc
attcaattaatccaaaaccatttcattgatgaatacgatccaactatcgaagattcatac
agaaaacaagttaccattgatgaagaaacttgtttattagatattttagatactgctggt
caagaggaatactctgcaatgagagaccaatatatgagaactggtcaaggtttcctttgt
gtctactctatcacttcaagatcatcatttgatgaaattgcatcattccgtgaacaaatt
cttagagttaaggataaggatagagtaccaatgattgtcgttggtaacaaatgcgatttg
gaatctgatcgtcaagtcacaactggtgaaggtcaagatttagcaaaatccttcggtagt
ccattccttgaaacctctgccaagattcgtgtcaacgttgaggaagctttctattcactc
gtacgtgaaatcagaaaagacctcaagggtgactctaaaccagaaaaaggcaagaagaag
agaccattaaaagcttgtactcttttataa

KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_92731Help
Entry
DICPUDRAFT_92731  CDS       T02090                                 

Gene name
rasG
Definition
(RefSeq) hypothetical protein
  KO
K07827  GTPase KRas
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
dpp04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:dpp00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    DICPUDRAFT_92731 (rasG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dpp04131]
    DICPUDRAFT_92731 (rasG)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:dpp04031]
    DICPUDRAFT_92731 (rasG)
Membrane trafficking [BR:dpp04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    DICPUDRAFT_92731 (rasG)
GTP-binding proteins [BR:dpp04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    DICPUDRAFT_92731 (rasG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 ATP_bind_1 Septin FeoB_N
Motif
Other DBs
NCBI-GeneID: 10505487
NCBI-ProteinID: XP_003291742
JGI: Dicpu1_92731
UniProt: F0ZWE6
LinkDB All DBs
Position
Unknown
AA seq 189 aa AA seqDB search
MTEYKLVIVGGGGVGKSALTIQLIQNHFIDEYDPTIEDSYRKQVTIDEETCLLDILDTAG
QEEYSAMRDQYMRTGQGFLCVYSITSRSSFDEIASFREQILRVKDKDRVPMIVVGNKCDL
ESDRQVTTGEGQDLAKSFGCPFLETSAKIRVNVEEAFYSLVREIRKDLKGDTKPEKNKKK
RNLKSCTLL
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgacagaatacaaattagttattgttggtggtggtggtgttggtaaatctgcccttact
attcaattaattcaaaaccactttattgatgaatacgatccaaccatcgaagattcatac
agaaaacaagttaccattgatgaagaaacttgtttattagatattttagatactgctggc
caagaagaatattcagcaatgagagatcaatatatgcgtactggtcaaggtttcctttgt
gtttattcaatcacctcacgttcatcatttgatgaaattgcttcattccgtgaacaaatt
cttagagttaaagataaggatagagttccaatgatcgtcgttggtaacaagtgcgattta
gaatcagatcgtcaagttactactggtgaaggtcaagatttagccaaatcattcggttgt
ccattcttagaaacttcagccaagattcgtgtcaatgttgaagaagctttctattcactc
gtccgtgaaatcagaaaagatctcaaaggtgataccaaaccagaaaagaacaagaaaaag
agaaaccttaaatcatgcactctcttataa

DBGET integrated database retrieval system