KEGG   Desulfitobacterium dichloroeliminans: Desdi_0493Help
Entry
Desdi_0493        CDS       T02390                                 

Definition
(GenBank) transcriptional regulator
Organism
ddl  Desulfitobacterium dichloroeliminans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR MarR_2 HTH_27 HTH_24 HTH_20 TrmB HTH_34 HTH_IclR HxlR
Motif
Other DBs
NCBI-ProteinID: AGA68034
UniProt: H1ICN2
LinkDB All DBs
Position
complement(506828..507283)
Genome map
AA seq 151 aa AA seqDB search
MRSMVFENEIWDFLRTISESMANAFRPIVEKYDLTLMQTRILVEVKEGGPHTVGTLGSII
GLSSGNASSMCKKLESAGFLRRVRDPEDERYVKIALTKHGEETIFQIEKALEHRCGAFLE
TKGEEEYQRFAECMGQVRLFIKEMYEFDSQK
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgagaagtatggtgtttgagaatgagatttgggattttttaaggacgattagtgagagt
atggccaatgctttccgcccgatcgttgaaaaatacgatttaactttgatgcaaactcgt
attttggttgaagttaaggaaggtggcccccacactgtaggtactttaggaagtatcatc
ggcctttccagtggtaatgcgtcatcaatgtgtaagaaattagaatcagctggcttctta
aggcgtgtacgagatcctgaagatgagcgttatgtaaaaatagctcttaccaagcatgga
gaagagaccatttttcagatagaaaaagccctcgaacatcgctgtggtgcgtttctggaa
accaagggtgaagaggaatatcagcgctttgccgaatgcatgggtcaagtgcggttgttt
attaaagaaatgtatgaatttgactcccaaaagtaa

DBGET integrated database retrieval system