KEGG   Desulfitobacterium dichloroeliminans: Desdi_0680Help
Entry
Desdi_0680        CDS       T02390                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
ddl  Desulfitobacterium dichloroeliminans
Pathway
ddl00010  Glycolysis / Gluconeogenesis
ddl00071  Fatty acid degradation
ddl00280  Valine, leucine and isoleucine degradation
ddl00310  Lysine degradation
ddl00330  Arginine and proline metabolism
ddl00340  Histidine metabolism
ddl00380  Tryptophan metabolism
ddl00410  beta-Alanine metabolism
ddl00561  Glycerolipid metabolism
ddl00620  Pyruvate metabolism
ddl00625  Chloroalkane and chloroalkene degradation
ddl01100  Metabolic pathways
ddl01110  Biosynthesis of secondary metabolites
ddl01120  Microbial metabolism in diverse environments
ddl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ddl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desdi_0680
   00053 Ascorbate and aldarate metabolism
    Desdi_0680
   00620 Pyruvate metabolism
    Desdi_0680
  Lipid metabolism
   00071 Fatty acid degradation
    Desdi_0680
   00561 Glycerolipid metabolism
    Desdi_0680
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Desdi_0680
   00310 Lysine degradation
    Desdi_0680
   00330 Arginine and proline metabolism
    Desdi_0680
   00340 Histidine metabolism
    Desdi_0680
   00380 Tryptophan metabolism
    Desdi_0680
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Desdi_0680
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Desdi_0680
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Desdi_0680
Enzymes [BR:ddl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Desdi_0680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AGA68209
UniProt: L0F2Y6
LinkDB All DBs
Position
711494..712864
Genome map
AA seq 456 aa AA seqDB search
MSDFKEMILQQRRYFEEGETKDLNFRMEKLKTLRKVIIDNEEEIREALRKDLNKTPFEAY
ATEIGIVLEELSYTFKHLPKWVKRKRVRTPITQFLATSFTYPEPHGITLIMSPWNYPFQL
AMAPLIGAIAAGNCSVIKPSEYSFNTSVVIEKLIKENFKEEFITVVRGGREANKTLLDEK
FDHIFFTGSVAVGKTVMEAASKHLTPVTLELGGKSPCIVDETANIDLAAKRIIWGKLLNS
GQTCVAPDYLLVHSSIKSKLIDKMKEYVVEFYGENPSKNEDYPKIINEKHFKRLQSLILG
EEIVFGGQFNEETRQISPTIVHNVTWDSPVMVEEIFGPILPVLEFEHLSEVISQINKHPK
PLALYFFTTIKEREEQILRDISFGGGCINDTIVHLATSYMPFGGVGESGMGGYHGKASFD
TFSHQKSIMKRSNLLDIPFRYPPFKNKLSLVKKVMR
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatttcaaagaaatgatccttcagcaaagaagatactttgaagagggtgaaacc
aaagatctgaattttcgtatggagaagctcaagaccttaagaaaggtcattattgataat
gaagaagaaatcagggaggctttgcgtaaagacttaaacaagacgccctttgaggcctat
gctacagaaatagggattgttttagaagaattgagttacacattcaagcatctaccgaaa
tgggtgaaaaggaaaagggtaagaacaccgataacccaattcctagccacaagcttcacc
tatcccgaaccccatggaataaccctgattatgtctccctggaactatcccttccagctt
gcgatggcacccttgattggcgccatcgctgcaggcaattgctcggttattaaaccctct
gagtattccttcaatacctctgtagtaatcgagaagctcataaaagagaatttcaaagag
gaatttattacggtagtacgcggtgggagagaagctaataaaaccttgttggatgaaaaa
tttgatcatatcttctttacaggaagtgtagcggttggtaagacagtcatggaagcagcc
tccaaacaccttacccctgtaactctggagttgggtggtaaaagcccttgcattgtggat
gaaactgcaaatatagacttggcggccaagcgaatcatttggggaaagctcttgaattca
gggcaaacatgcgtagctccggattatctcctagttcacagtagtatcaagagcaagctt
attgataaaatgaaagaatacgtggttgagttttacggggaaaatcccagtaaaaatgaa
gactatccaaagataattaatgaaaagcattttaagcgattgcaaagccttatcctaggt
gaagaaattgtcttcgggggacaatttaatgaagaaacccgtcaaatctccccaaccatt
gttcataatgtaacctgggacagtccagtcatggtggaagagatttttggacccattttg
ccggtgctggaatttgagcacttaagcgaggttatttctcaaatcaataaacatcccaaa
cccttggcactctacttctttactactataaaggaaagagaagaacagatccttagggat
atctcgtttggtggaggatgtatcaacgataccattgtgcacttagcgacttcctatatg
cccttcggtggggttggtgaaagtggaatgggaggatatcatggtaaggcgagttttgat
accttttcacatcaaaaaagtattatgaaaagatctaatttgttggatattcctttcagg
tatccaccctttaaaaataagttaagcttagtaaaaaaggttatgagatag

DBGET integrated database retrieval system