KEGG   Desulfitobacterium dichloroeliminans: Desdi_1241Help
Entry
Desdi_1241        CDS       T02390                                 

Definition
(GenBank) phosphoribosyl-AMP cyclohydrolase
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
ddl  Desulfitobacterium dichloroeliminans
Pathway
ddl00340  Histidine metabolism
ddl01100  Metabolic pathways
ddl01110  Biosynthesis of secondary metabolites
ddl01230  Biosynthesis of amino acids
Module
ddl_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:ddl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Desdi_1241
Enzymes [BR:ddl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     Desdi_1241
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     Desdi_1241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG Rad21_Rec8
Motif
Other DBs
NCBI-ProteinID: AGA68753
UniProt: L0F718
LinkDB All DBs
Position
1278111..1278791
Genome map
AA seq 226 aa AA seqDB search
MTTENPEESTVVIPEGIRWNEDGLIPAIVQDVNTQKVLMLAYMNEEALRLTLKENRAWYY
SRSRQSLWLKGETSGNIQQVMELRFDCDQDAILLTVQQKGVACHEDYYSCFHYAAQGREF
VPLGEPKVIPPLPLGRTLELLAEVIHSRNLERPEGAYTTYLFEKGIDKILKKVGEESAET
IIAAKNSSVEEIRYEVSDLFYHLLVLLEERGVTLQEISQELLARKK
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgacaactgagaatccggaggaatcaacggtagtgattccggaaggaatccgatggaat
gaggatggtttaatacctgcgatcgtgcaggatgtaaatacccagaaggttttgatgttg
gcctatatgaacgaggaagctctgcgcttgaccttgaaggaaaacagggcctggtattat
agtcggagccgccaatccctttggttgaaaggggagacctcaggtaatatccagcaggtt
atggagctccgctttgactgtgatcaagatgccattttattgacagtgcagcaaaaaggg
gtagcttgtcatgaagattattattcttgcttccattatgcagcccaagggcgggagttt
gtaccgcttggtgagcctaaggtcattccacccctccctttaggtagaactcttgagctc
ctggcggaagtgattcattctcgcaatttggagcgccccgaaggggcctataccacatat
ttgtttgaaaagggcattgataagattttgaaaaaggtaggtgaggaaagcgcggagaca
atcattgcggccaagaattcctcagtggaggagattcgctatgaagtatccgaccttttt
tatcatctcttagtcttgcttgaagagcgcggagtaacgctccaggaaatttcacaagaa
ttgcttgcccgaaaaaaataa

DBGET integrated database retrieval system