KEGG   Desulfitobacterium dichloroeliminans: Desdi_2227Help
Entry
Desdi_2227        CDS       T02390                                 

Definition
(GenBank) arabinose efflux permease family protein
Organism
ddl  Desulfitobacterium dichloroeliminans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_1_like MFS_2 Sugar_tr
Motif
Other DBs
NCBI-ProteinID: AGA69660
UniProt: L0F9G5
LinkDB All DBs
Position
complement(2279152..2280330)
Genome map
AA seq 392 aa AA seqDB search
MKKEFIRPMIILILVQFLVMVGFGIVIPILPFLIEELGGGAFSLGLFMSAYSIMQFFFAP
FWGRLSDRIGRRPVLLIGLSGYGITFFLFGLAGNLPLLIAFRALSGMVSSATLPTAMAYM
ADITEGADRSKSMGMLGAAMGLGMVFGPALGGWLGDYSFTLPFYFAGTLALLVLPFAWKF
LPETLKEPNKEPKKKVRLNFSVIRDPLFPLFVFSFVLSFTMAMFETTFTLFAAERVGFGP
KEMGMVFMIIGIVGVIVQGMLIGKVVKRFGDAKPAKFGALLCAFAFLWMLWAPNAVLLVL
GTMVFMTGNSLMTPTSSSLVTKNNHNHQGASLGVFQSFGSLGRIIGPLIGGGIYELSMNT
PYIIGIVTLVLCVIIFGARIQDKKAEESGFSV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagagttcattcgtcccatgatcatcttgattctcgtccagtttttagtgatg
gtgggattcgggattgtcatacctattcttccctttttgattgaagagctgggaggagga
gcattctctctagggttattcatgtccgcgtattccatcatgcagtttttctttgctcct
ttctggggacgtttatcggatcgaatcggcagacgacccgtcctcctcattggtctcagt
ggctatggaataacgttctttctattcggtctcgccgggaatcttccgcttctcatcgcc
tttcgagctctatccgggatggtctcctcggcaacgctgcctacagcgatggcctatatg
gccgatataactgagggagctgatcggtcaaagagcatgggaatgctcggtgcagcgatg
ggattaggaatggtctttggccctgccctgggtggatggctaggagattatagcttcacc
ttgcccttctattttgcgggaaccttagcgctccttgttctgccctttgcctggaagttc
ctccctgagaccctgaaagaacccaataaagagcctaagaaaaaggtgcggttaaatttc
agtgtgattcgcgatccgttattcccattatttgtctttagcttcgtgctcagttttacc
atggccatgtttgaaaccacctttaccttgtttgctgccgagcgggtgggcttcggcccc
aaagaaatgggtatggtattcatgattatcggaattgttggcgtgattgttcagggaatg
ctgatcgggaaggtggtcaagcggtttggtgatgccaaacccgccaagttcggagcactt
ctctgtgccttcgcttttctttggatgctctgggctcccaatgcagtgcttctggtttta
ggaacgatggtgttcatgacaggcaattctttaatgacaccaaccagttccagcttagta
acaaagaataaccataatcaccagggtgcatcactgggagtttttcaatccttcggcagc
ttaggacgaatcattggtccactgatcggagggggtatctatgaattatccatgaataca
ccttatattattggtatagtaaccttggtcctgtgtgtaatcatctttggcgcaagaatt
caagataaaaaagcagaggagtcaggtttttcagtataa

DBGET integrated database retrieval system