KEGG   Desulfovibrio desulfuricans ND132: DND132_0067Help
Entry
DND132_0067       CDS       T01709                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
ddn  Desulfovibrio desulfuricans ND132
Pathway
ddn00970  Aminoacyl-tRNA biosynthesis
ddn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddn00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DND132_0067
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ddn03029]
    DND132_0067
Enzymes [BR:ddn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     DND132_0067
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     DND132_0067
Mitochondrial biogenesis [BR:ddn03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    DND132_0067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY YjbR
Motif
Other DBs
NCBI-ProteinID: EGB13285
UniProt: F0JCV7
LinkDB All DBs
Position
69441..70874
Genome map
AA seq 477 aa AA seqDB search
MSRYETVIGLEVHAQLKTESKIFCSCSTKFGNDPNENVCAVCSGMPGVLPVFNEKVAEYA
TKAGLATDCVINLKSVFARKNYFYPDLPKGYQISQFEQPICEHGHVDIEVDGERKRVGLT
RIHMEEDAGKNIHSAADNVSFVDLNRTGVPLIEIVSEPDMRSAEEAVAYLKELRSVLLYL
GICDGNMEEGSFRCDANVSIRPYGQEAFGTRAELKNLNSFKHIQKAIEYEVERQIDLVED
GEQVIQETRLYNVEKGTTHSMRGKEEAHDYRYFPDPDLVPLVLDQAWVDKWRSELPELPS
AKRARFMAEYDLADYDAALITGDLAVADYFEAAVKAYAGDPKKVTNWVVGELLPFCHESG
TEACGVRLTPDKLAALLALVDDGTISVKIGKDIFRDLCATGDDPAAYVEAKGLVQVSDTS
ELEAMVDKVIADNPSEVEAYKGGKTKLMGFFMGQVMRLSKGQANPGVVTQLFTKKLS
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgctacgaaaccgtcatcggcctggaagtccatgcccagttgaagaccgagagc
aagatattctgctcctgctcgaccaagttcggcaacgaccccaacgagaacgtctgcgcg
gtctgctccggcatgcccggcgtgctgcccgtgttcaacgagaaggtcgccgagtacgcc
accaaggcgggcctggccacggactgcgtcatcaacctcaagtccgtgttcgcgcgcaag
aactacttctatcccgacctgcccaaggggtaccagatttcccagttcgagcagcccatc
tgcgagcacggccacgtcgacatcgaggtggacggcgagaggaagcgggtgggtctgacc
cgcatccacatggaagaggatgcgggcaagaacatccactcggcggcggacaacgtcagc
ttcgtggacctcaaccggaccggcgtgccgctcatcgagatcgtgtccgagccggacatg
cgctcggccgaggaggccgtggcctacctgaaggaactgcgctcggtcctgctctacctc
ggcatttgcgacggcaacatggaggagggctcgttccgctgcgacgccaacgtgtccatc
cggccctatggccaggaggcgttcggcacccgcgcggagctgaagaacctcaactcgttc
aagcacatccagaaggccatcgagtacgaggtggagcgccagatcgacctggtggaggac
ggcgagcaggtcatccaggagacccggctgtacaacgtggaaaagggcacgacccactcc
atgcgcggcaaggaggaggcccacgactatcgttatttcccggatccggacctggtgccc
ctggtcctggaccaggcctgggtggataagtggcggtccgagctgcccgagctgccctcg
gccaagcgcgcccggttcatggccgagtacgacctggccgactacgacgcggccctgatc
accggcgacctcgccgtggccgactacttcgaggcggcggtcaaggcctacgcgggcgat
cccaagaaggtcaccaactgggtggtcggcgaactgctgccgttctgccacgagagcggg
accgaggcctgcggggtccggctgaccccggacaagctggccgcgctgctcgccctggtg
gacgacgggaccatctcggtcaagatcggcaaggacattttccgcgacctgtgcgccacc
ggcgacgacccggccgcctatgtcgaggccaagggactggtccaggtgtccgacacctcg
gaactggaggctatggtggacaaggtcatcgccgataacccgtccgaggtcgaggcctac
aagggcggcaagaccaagctcatgggcttcttcatgggccaggtcatgcgcctgtccaag
ggccaggccaaccccggcgtggtcacgcagctgttcacgaagaaactttcgtaa

DBGET integrated database retrieval system