KEGG   Desulfovibrio desulfuricans ND132: DND132_2876Help
Entry
DND132_2876       CDS       T01709                                 

Definition
(GenBank) malic protein NAD-binding protein
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
ddn  Desulfovibrio desulfuricans ND132
Pathway
ddn00620  Pyruvate metabolism
ddn01100  Metabolic pathways
ddn01120  Microbial metabolism in diverse environments
ddn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ddn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DND132_2876
Enzymes [BR:ddn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     DND132_2876
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: malic Malic_M ELFV_dehydrog AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: EGB16079
UniProt: F0JJI0
LinkDB All DBs
Position
complement(3209103..3210425)
Genome map
AA seq 440 aa AA seqDB search
MALFTKQEALDYHSIGRKGKVEVVPVKPCKTQKHLSMAYSPGVAEACKAIHADPELVYEY
TGKGNLVGVVSNGTAVLGLGNIGPLAGKPVMEGKGVLFKVFGDVDVYDIDLDVSDPDKLC
DIVKALEPTFGGINLEDIKAPECFYIEEKLKKEMNIPVFHDDQHGTAIVTSAGMMNAIEI
SGKNAADMRVVISGAGAAAIACTNLYRNMGVKFENIAMFDSKGHINKPRTDLNEFKQQYA
TEKEYASLAEAMVGADCFLGLSKGGVVSKEMVKSMSDNCPIIFACANPDPEITYDDAKSA
RPDCIMGTGRSDFPNQVNNVLGFPFIFRGALDCGATAITEGMKLAAAQALADLAKTEAPQ
YVCEAFGVDKLEFGIDYVIPKALDLRLIEYVSVAVAKAAMEEGVARKQLDLDEYKASLGK
RIQASSARVSAFVDTYHLGI
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggcattattcaccaaacaagaggccctggactatcattccatcggccgcaaggggaag
gtcgaggtcgtcccggtcaagccgtgcaagacccagaaacatctgtccatggcgtacagc
cccggcgtggccgaggcgtgcaaggccatccacgccgatcccgaactggtctacgaatac
accggcaagggcaacctggtcggcgtggtttccaacggcaccgccgtgctcggcctgggc
aacatcgggcccctggcgggcaagccggtcatggagggcaagggcgtgctgttcaaggtc
ttcggcgacgtggacgtctacgacatcgacctggacgtcagcgacccggacaagctgtgc
gacatcgtcaaggccctggagccgaccttcggcggcatcaacctcgaagacatcaaggcc
ccggaatgcttctacatcgaagagaagctgaaaaaggaaatgaacatcccggtcttccat
gacgaccagcacggcacggccatcgtcacctccgccggcatgatgaacgccatcgagatc
tcgggcaagaacgccgccgacatgcgcgtggtcatctccggcgcgggcgcggcggccatc
gcctgcaccaacctgtaccggaacatgggcgtcaagttcgagaacatcgccatgttcgac
tccaagggacacatcaacaagccccgcacggacctgaacgagttcaagcagcagtacgcc
accgagaaggaatacgcctccctggccgaggccatggtcggcgcggactgcttcctgggc
ctgtccaagggcggcgtggtcagcaaggagatggtcaagtccatgtccgacaactgcccg
atcatcttcgcctgcgccaacccggacccggagatcacctacgacgacgccaagtccgcc
cgccccgactgcatcatgggcaccggccgctcggacttcccgaaccaggtcaacaacgtg
ctcggcttcccgttcatcttccgcggcgcgctcgactgcggcgccacggccatcaccgaa
ggcatgaagctggccgccgcccaggccctggccgacctggccaagaccgaggccccgcaa
tacgtctgcgaggccttcggcgtggacaaactcgagttcggcatcgactacgtcatcccc
aaggccctggacctgcggctcatcgagtacgtctccgtggccgtggccaaggccgccatg
gaggagggcgtggcccgcaagcaactcgacctggacgaatacaaggcctcgctcggcaag
cgtatccaggcctccagcgcccgcgtgagcgctttcgttgatacttatcatcttggaatc
taa

DBGET integrated database retrieval system