KEGG   Desulfovibrio desulfuricans ND132: DND132_3085Help
Entry
DND132_3085       CDS       T01709                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K16153  glycogen phosphorylase/synthase [EC:2.4.1.1 2.4.1.11]
Organism
ddn  Desulfovibrio desulfuricans ND132
Pathway
ddn00500  Starch and sucrose metabolism
ddn01100  Metabolic pathways
ddn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ddn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DND132_3085
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ddn01003]
    DND132_3085
Enzymes [BR:ddn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     DND132_3085
    2.4.1.11  glycogen(starch) synthase
     DND132_3085
Glycosyltransferases [BR:ddn01003]
 Polysaccharide
  Storage polysaccharide
   DND132_3085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycogen_syn DUF3417 Phosphorylase Glyco_transf_5 Glyco_transf_4 Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-ProteinID: EGB16288
UniProt: F0JK39
LinkDB All DBs
Position
complement(3437195..3441433)
Genome map
AA seq 1412 aa AA seqDB search
MDKSWLFEVSWEVCNKVGGIYTVISSKAPQAKAAFDNRYVAVGPLLDRNPGFLPSDPPDT
VRPALERLKAWGIETATGQWDIPGKPLVLLIGFRNAFPAHDKLLFQLWNDYGVDSMAGGW
DYIEPVLFSTAAAMAIKEISEDVGEGADVYAHFHEWMSGAGVLHLKKHAPSVSTVLTTHA
TMLGRAMSGAGVDIYKRLEEIEPSQEAKAYGVTAKHSMESVSAREADCFTTVSNITRREA
SNLLGTNPAVVTVNGFNLDGFADPTAVAQTRKRSRKQLLDLAANFLERDLDPAKTLLVAT
SGRYEFHNKGIDLLLDGLGDLNEELAKSGKDVTVVAFLLVSCGYAGFSDEARRRLKQERY
DIEKYAGISTHHLGDADHDPVVMKCRERKLDNEAVNRCCVIFIPVYLDGNDGVLNLEYYD
ALAGMDLTVFPSFYEPWGYTPMESAAFAVPTVTSDRAGFGQWIMERHPQGHPGVHVLNRL
EDDYETARENLALYLSDFTRWTPEERVSRSKEARKIAEEATWAHFYPRYLEAYEYAADIR
TERIAGVQRMVAAPGAEISFSGVNTTQPRLRSFTVVTELPAPLARLRDVAENLWWVWHRD
SQELFEWMDADKWHESGHNPVLFLDTMRRDRLAELADDPEFIGRLNSVLERFDAYMAESA
KADVRGITWKNPVAYFSMEFGLHEAIPVYSGGLGLLSGDHIKSASDLNLPFIGISLLYKN
GFFHQRINGNGDQVVEYHENNFATMPITPLQRNDEKVMITVDLPGRTVYAQIWEVHVGRA
RLYLLDTDVVENSRSDRDITSKLYDPTSKGRIEQEIILGVGGIRLFTALDIVPSVYHLNE
GHSAFLLFERIRQLMLLDGVDFPTAKEIVRGNTVFTMHTPVPAGNERFEKSLVENYFRGY
ADEMGVPWDGLWNLGHIYAEEADHLNMTVLALQLSCKRNGVSRLHGDVSRRMWQDLWRGF
ILSEVPVGHVTNGVHITSWLDERVRHDIEESCSMSVHRQLLEKTDWGCLDGLDDRRLWDT
HVALKHRLYDEVRRSIAAQWTREGEPPNRLHAFLNELNPDHLTLCFARRCTAYKRPTLIF
HNLQRIKEILTKADRPVNIIFAGKAHPADTMGASYINLICRLAKQDDFLGRVIFLESYDI
RLARLLVSGADVWLNNPTRLMEASGTSGMKAAVNGVPNCSILDGWWDEAFDGTNGWAVGS
GLVYQSQVNQDIVDADNLYATLESEVVPEFYDRGGDGVPHAWLQRMKASMQTAFRQYGTH
RMVRDYIDDMYLPAIELSKLRAKNNNELALGLGEWRTRIPGRFATVNIKEVKVEGISGDV
FRLGNRLTVSAKVDRGQLLTEEIVVEFVAATPDEETVVDCIPMQLKHTEGSTLLYRATYS
PAESGLVRYGVRVLPTHPGLASKCDPRLIRWS
NT seq 4239 nt NT seq  +upstreamnt  +downstreamnt
atggataaaagctggctgttcgaagtttcctgggaagtgtgcaacaaggtcggcggcatc
tacaccgtcataagcagcaaggccccgcaggccaaggcggccttcgacaaccgttacgtg
gccgtgggtccgctgctcgaccgcaaccccgggttcctgccctccgatccgcccgacacg
gtccgcccggccctggaacggctcaaggcctggggcatcgagaccgccaccggccagtgg
gacatcccgggcaagccgctggtcctgctcatcggcttccgcaacgccttcccggcccac
gacaagctcctgttccagctgtggaacgactatggcgtggattccatggccggaggctgg
gactacatcgaaccggtcctgttctccacggccgcggccatggccatcaaggaaatcagc
gaggacgtgggcgaaggggccgacgtctacgcccacttccacgagtggatgtccggggcg
ggcgtgctccacctgaagaagcacgcgccctcggtgtccacggtcctgaccacccacgcc
accatgctcggccgggccatgtccggggcgggcgtggacatctacaagcggctcgaagag
atcgagccgtcccaggaggccaaggcctacggggtcacggccaagcactccatggagtcg
gtctcggcccgcgaggcggactgcttcaccacggtctccaacatcacccggcgcgaggcc
tccaaccttctcggcaccaacccggccgtggtcacggtcaacggcttcaacctcgatggg
ttcgccgaccccacggccgtggcccagacccgcaaacgttcgcgcaagcagctcctggac
ctggccgccaacttcctcgaacgggacctggacccggccaagaccctgctggtggcgacc
tccggacgctacgaattccacaacaagggcatcgacctgctcctggacgggctgggcgac
ctgaacgaggagctggccaagtccggcaaggacgtcaccgtggtcgccttcctgctcgtc
tcctgcggctacgcgggcttcagcgacgaggcccggcgccgcctcaagcaggagcgctac
gacatcgagaagtacgcgggcatctccacccaccacctgggcgacgcggaccacgacccc
gtggtcatgaagtgccgcgagcgcaagctggacaacgaggccgtgaaccgctgctgcgtc
atcttcatcccggtctacctggacggcaacgacggcgtgctcaacctggaatactacgac
gccctggcgggcatggatctgaccgtgttcccgtccttctacgaaccgtggggctacacc
cccatggagagcgcggccttcgccgtgcccacggtgacctcggaccgggccggcttcggc
cagtggatcatggagcggcacccccagggacaccccggcgtgcacgtcctcaaccggctg
gaggacgactacgagaccgcgcgcgagaacctggccctctacctctcggacttcacccgc
tggacgcccgaggagcgcgtctctcgcagcaaggaggcccgcaagatcgccgaggaggcc
acctgggcccacttctatccccgctacctggaggcctacgagtacgcggccgacatccgc
accgaacgcatcgcgggcgtgcagcgcatggtcgccgcgcccggcgcggagatcagcttc
tcgggcgtgaacacgacccagccgaggctgcggtccttcaccgtggtcaccgagctgccc
gcgcccctggcccggctgcgcgacgtggccgaaaatctctggtgggtctggcaccgcgac
tcccaggagctgttcgaatggatggacgcggacaaatggcacgagagcggccacaacccg
gtcctgttcctggacaccatgcgccgcgaccggctggccgaactggccgacgacccggaa
ttcatcggccgcctgaactcggttctggagcggttcgacgcctacatggccgagagcgcc
aaggccgacgtcaggggcatcacctggaagaacccggtggcctacttctccatggagttc
ggcctgcacgaggccatcccggtctactccggcggcctgggcctgctctccggcgaccac
atcaagtcggccagcgacctgaacctgccgttcatcggcatctccctgctgtacaagaac
ggcttcttccaccagcgcatcaacggcaacggggaccaggtggtcgagtaccacgagaac
aacttcgccaccatgcccatcaccccgctccagcggaacgacgaaaaggtcatgatcacc
gtggacctgccgggccgcaccgtgtacgcccagatatgggaggtccacgtgggccgggcc
aggctctacctgctcgacacggacgtggtcgagaactcccgctcggaccgggacatcacc
tccaagctctacgacccgacctccaagggccgcatcgagcaggagatcatcctcggcgtg
ggcggcatccggctgttcaccgccctggacatcgtcccgtcggtctaccacctcaacgag
ggccactccgccttcctgctcttcgagcgcatccgccagctcatgctcctggacggggtg
gacttccccacggccaaggagatcgtccggggcaacaccgtgttcaccatgcacaccccc
gtgcccgcgggcaacgaacggttcgagaagtccctggtggagaactacttccggggctac
gccgacgagatgggcgtgccctgggacgggctgtggaacctcgggcacatctacgccgag
gaggccgaccacctgaacatgaccgtgctggccctgcagctctcctgcaagcgcaacggc
gtctcccgcctgcacggcgacgtgtcccggcgcatgtggcaggatctgtggcgcggcttc
atcctgagcgaggtcccggtgggccacgtgaccaacggcgtgcacatcacctcctggctg
gacgagcgcgtccgccacgacatcgaggagtcgtgcagcatgtccgtacaccgccagctc
ctggaaaagaccgactggggctgcctggacggcctggacgaccggcggctgtgggacacc
cacgtggccctcaagcaccgcctctatgacgaggtgcgccgctccatcgccgcccagtgg
acccgcgagggcgaaccgcccaaccggctgcacgccttcctgaacgagctcaacccggac
cacctgaccctgtgcttcgcgcggcgttgcacggcctacaagcggcccaccctgatcttc
cacaacctccagcggatcaaggagatcctgaccaaggccgatcgcccggtgaacatcatc
ttcgcgggcaaggcccacccggccgacaccatgggcgcgagctacatcaacctcatctgc
cggctggccaagcaggacgacttcctgggccgggtcatcttcctggagagctacgacatc
cgcctggcgcggctgctcgtgtccggcgcggacgtctggctgaacaaccccacccggctc
atggaggccagcggcaccagcggcatgaaggccgcggtcaacggcgtgcccaactgctcc
atcctggacggctggtgggacgaggccttcgacggtaccaacggctgggccgtgggcagc
ggcctggtctaccagagccaggtcaaccaggacatcgtggacgcggacaacctgtacgcc
accctggaatccgaggtggtccccgagttctacgaccggggcggcgacggcgtgccccac
gcctggctgcaacgcatgaaggcgtccatgcagaccgccttccgccagtatggcacccac
cgcatggtccgggactacatcgacgacatgtacctgcccgccatagagctgtccaagctg
cgcgccaagaacaacaacgaactggccctgggcctgggcgaatggcgcacgcgcatcccc
ggccgcttcgccaccgtgaacatcaaggaggtcaaggtggagggcatcagcggcgacgtc
ttccgcctgggcaaccggctgacggtctcggccaaggtggaccggggccagctgctgacc
gaggagatcgtggtcgaattcgtggccgccaccccggacgaggagaccgtggtggactgc
atccccatgcagctcaagcacaccgagggctccaccctgctctaccgggccacctacagc
ccggccgagtccgggctcgtgcgctacggcgtccgcgtcctcccgacgcatccggggttg
gcaagcaagtgcgaccccagattgataaggtggagctag

DBGET integrated database retrieval system