KEGG   Dokdonia donghaensis: I597_0328Help
Entry
I597_0328         CDS       T04309                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
ddo  Dokdonia donghaensis
Pathway
ddo00020  Citrate cycle (TCA cycle)
ddo00310  Lysine degradation
ddo00380  Tryptophan metabolism
ddo01100  Metabolic pathways
ddo01110  Biosynthesis of secondary metabolites
ddo01120  Microbial metabolism in diverse environments
ddo01130  Biosynthesis of antibiotics
ddo01200  Carbon metabolism
Module
ddo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ddo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ddo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    I597_0328 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    I597_0328 (sucA)
   00380 Tryptophan metabolism
    I597_0328 (sucA)
Enzymes [BR:ddo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     I597_0328 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: ANH59260
LinkDB All DBs
Position
complement(395894..398710)
Genome map
AA seq 938 aa AA seqDB search
MSKNVNYRIFAFLKSQDAELKYQMDRFSFLNAAHTAYFAELYDQYLLNPDSVEASWRAFF
QGFDFGLESAEEVTGDVGGETVVIPEGIQKEFQIVKLIDGYRNRGHLFTKTNPVRARRKY
APTLEIENFGLSKSDLSTEFEAGSILGIGKKTLQEIVNHLEAIYCDHIGIEYMYIRNPEE
IAWIQNWLNKNDNHPSFSKEEKRHILKKLNQTASFEGFLHSKYVGQKRFSVEGLDAMIPG
LDTLIERGSDKGVEQFVVGMAHRGRLNVLANIFGKSPEAIFSEFDGKEYDEDELFDGDVK
YHMGWTSFRESDKGHKIRMDLAPNPSHLETVGAVIEGMSRAKIDNQLGGDEKKILPIAIH
GDAAVAGQGIVYEIVQMAQLEGYRTGGTIHIVANNQVGFTTNYLDARSSTYSTDVGKVTL
SPVLHVNADDVESVCHAFAFALDFRMQFGRDVFIDILGYRKYGHNEGDEPRFTQPLLYKA
ISKHANPRDIYAERLLKEGVIEKGYVKQLEKEYKDDLEEDLEESRKRDKTVITEILADDW
EGYEIGSREDILTPVDTTYDISKLDVIADGITKLPEDKKFIRKIQRIVADRNKQYTEKNQ
LDWGMGELLAYGSLMEEGFNVRISGQDVERGTFSHRHAIIKTEDDVEEINLHNRLGVAGK
MDIYNSLLSEYGVVGFDYGYAMAAPKTLTIWEAQFGDFSNGAQIMLDQYISAAESKWKTQ
NGLVMLLPHGYEGQGSEHSSARMERYLQLCATDNLIMADVTTPANFFHLLRRQMKWNFRK
PLVVFTPKSLLRHPLVVSTKEELTTGSFQEVLDDTEVDKKKVTSLVFCTGKFYYDLLERR
KENGRDDVALVRIEQLFPLPQKQLEDIIASYPNVTDYVWAQEEPRNMGAWGYMLMNFDQV
KLRVASRRVYASPAAGSSTRSKARHKKVIDSVFEAPVK
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaaatgttaattatcgtatttttgcttttctaaagtcgcaagacgcagaactt
aaatatcaaatggatagattttcatttctgaatgccgcacataccgcttactttgctgag
ctttacgatcaatatttacttaacccggatagtgtagaagctagctggcgcgcttttttt
caaggttttgactttgggctagaaagtgcagaagaggttactggtgatgtagggggagag
actgtggttattcctgaaggaattcaaaaagaatttcaaatagtaaaattaatagacgga
taccgtaacagaggtcacctctttacaaagactaaccctgtacgtgcacgtcgtaaatat
gcacctacactagagatagaaaactttggactctctaagtctgatcttagtacagagttt
gaagctggttcaattttaggtattgggaagaagacgttacaagagattgtaaatcacctt
gaggccatatattgtgaccacataggtattgagtatatgtacattcgtaatccagaagag
attgcttggatacagaactggctcaataaaaatgataaccatccttctttttcaaaagag
gaaaaaaggcatattctcaaaaaattaaatcaaacagcttcttttgaaggtttcttgcac
tctaagtatgtagggcaaaaacgtttttctgtagaaggacttgacgctatgattccggga
cttgatacgcttatcgagagagggtctgataaaggtgttgagcaatttgtagtagggatg
gcacaccgtggtcgtcttaatgtactggcaaatatcttcggaaaatcaccagaggcaatc
ttttctgagtttgacggaaaagagtatgatgaggatgagctttttgatggagatgtaaaa
taccatatggggtggactagctttcgcgaaagcgataagggacacaaaatacgtatggac
ctagcacctaacccatctcacctcgagactgtaggagcagtgatagaggggatgtctcgt
gcaaaaatagataatcagttaggaggagatgagaagaaaatccttcctattgctatacac
ggagatgctgccgtagctggtcaaggtattgtatatgaaattgtgcaaatggcacagtta
gaaggatatcgaacgggtggtacgatacatattgtagcaaataaccaagtaggttttact
acaaactatctcgatgcgagatcatctacctatagcacagatgtgggtaaggttactttg
tctccagtactacacgtaaatgcagatgatgtagagtctgtatgtcacgcatttgccttt
gcacttgattttagaatgcaatttggtcgtgatgtatttatagacatactaggttataga
aagtatggacataatgaaggtgatgagcctagatttacacagcctttactatataaagca
atctcaaaacacgcaaatccacgtgatatctatgcagaaagacttcttaaagaaggggtt
atagaaaagggatacgtaaagcagctcgaaaaagaatataaagatgatcttgaagaagat
cttgaagaatctcgtaagagagataaaacagtaattactgagattcttgcagatgactgg
gaagggtatgagataggaagtagagaagatattcttactcctgtagatactacctatgat
ataagtaagctagatgttatagcagatggtattactaagttaccagaagataaaaaattc
atacgcaagatacagcgtatagttgcagatagaaataagcagtatacagaaaagaatcaa
ttagactggggaatgggtgagcttcttgcttacggttctcttatggaagaaggatttaat
gtacgtatatctggacaagatgtagagagaggaacattctctcaccgtcacgctattatc
aaaacagaagatgatgtagaggagattaatctacacaaccgtttaggcgtagctggtaag
atggatatctataactcactactctctgagtatggagtggtaggttttgactacgggtat
gcgatggctgctcctaagacacttactatctgggaggctcaatttggagatttttcaaat
ggcgcacagataatgctagaccaatacataagcgctgcagagtctaagtggaaaacacaa
aacggactcgtgatgttattgcctcacgggtatgaaggtcaaggttctgagcactctagt
gctcgtatggaacgttacctccagctttgtgctacagataaccttataatggcagatgta
actacgccagcaaacttcttccacctactacgtcgccagatgaagtggaattttagaaaa
ccgcttgtagtctttacacctaagtcactattaagacatcctcttgtagtgagtactaaa
gaagagcttaccacaggctcttttcaagaagtacttgacgatactgaggtagataagaaa
aaggttacatcacttgtattctgtacaggtaagttttattatgatctcttagagcgtcgt
aaggaaaatggccgtgatgatgtagcccttgtacgtatagagcaattattcccactgcca
caaaagcagttagaagatattatcgcaagttatcctaatgtaacagattatgtctgggca
caagaagagcctagaaatatgggagcttggggttatatgcttatgaattttgatcaagta
aaacttagagtagcatcgcgacgtgtatatgcatctccagctgcgggaagtagtacaaga
tcaaaagcaagacacaaaaaagtaatagatagcgtttttgaagcgcctgtaaaatag

DBGET integrated database retrieval system