KEGG   Dokdonia donghaensis: I597_0765Help
Entry
I597_0765         CDS       T04309                                 

Gene name
tdk
Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
ddo  Dokdonia donghaensis
Pathway
ddo00240  Pyrimidine metabolism
ddo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    I597_0765 (tdk)
Enzymes [BR:ddo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     I597_0765 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: ANH59694
UniProt: A0A0A2GUX6
LinkDB All DBs
Position
875286..875942
Genome map
AA seq 218 aa AA seqDB search
MFLENTVNHKEQFGWIEVICGSMFSGKTEELIRRLKRAQFAKQKVEIFKPAVDVRYDEEM
VVSHDSNEIRSTPVPAAANIPILADDCDVVGIDEAQFFDDEIVKVCNDLANRGIRVIVAG
LDMDFKGNPFGPMPNLMATAEYVTKVHAVCTRTGNLAQYSYRKAQGQDIVMLGETEEYEP
LSRAAYFKAMLRDRLRKMDVDQPEEITPTQKETPQDPG
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcgaaaatacagtaaatcataaagagcaatttggctggatagaagtcatttgt
gggtcgatgttctctggtaaaacagaagaactcatccgtaggctcaagcgcgcgcagttt
gcaaaacaaaaagtagaaatctttaaacctgcggtagacgtgcgctatgatgaagaaatg
gtagtctctcacgactcaaatgagatacgatctacacctgtaccagcagcagcaaatatt
cctattcttgcagatgattgtgatgtggtaggtatagatgaagcacagttttttgacgat
gagattgtaaaggtgtgtaatgatcttgcaaaccgaggtataagagtaatcgttgctgga
cttgatatggattttaaaggaaacccctttggacctatgcctaaccttatggcaacagca
gagtatgtgactaaagtacacgccgtttgtactcgcacaggtaatctagcgcaatacagt
tatagaaaagcacaaggccaagatattgtaatgctaggcgagacagaagagtatgaaccc
ctatctagagcggcatattttaaagcaatgctgcgtgatcgtcttcgtaagatggatgta
gatcaaccagaagagataactcctactcaaaaagagactcctcaagaccctggctag

DBGET integrated database retrieval system