KEGG   Dickeya dianthicola: DDI_0286Help
Entry
DDI_0286          CDS       T05141                                 

Definition
(GenBank) Alkyl hydroperoxide reductase protein F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ddq  Dickeya dianthicola
Brite
KEGG Orthology (KO) [BR:ddq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DDI_0286
Enzymes [BR:ddq01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     DDI_0286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_oxidored Thioredoxin_3 FAD_binding_2 Glutaredoxin HI0933_like NAD_binding_8 Thi4 DAO FAD_binding_3 K_oxygenase AlaDh_PNT_C DSBA FMO-like
Motif
Other DBs
NCBI-ProteinID: ATO31454
LinkDB All DBs
Position
267789..269351
Genome map
AA seq 520 aa AA seqDB search
MLDNNMQLQLKAYLEKLTKPVELVATLDDSAKSAEVRELLTDIAGLSDKVSFFENNDLPV
RKPSFLITNPGAANGPRFAGAPMGHEFTSLVLALLQTGGHPSKEAQELLDQIRELDGKFH
FETYYSLTCHNCPDVVQALNLMSVLNPNVTHTAIDGGVFQDEIKDRNIMGVPTVFLNGEH
FGQGRMSLAEIVGKVDTGANARVVDKLNSRPVYDVLIVGSGPAGAAAAVYAARKGIRTGL
MGERFGGQILDTVDIENYISVPKTEGAKLATALKTHVDDYDVDVIDLQSAQKLIPASEPG
QPHQIETVSGAVLKSRSIIIATGARWRNMNVPGEDQYRTRGVTYCPHCDGPLFKGKHVAV
IGGGNSGVEAAIDLAGVVKHVTLLEFAPELKADSVLQDKLRSLPNVDVIVNAQTTEVLGD
GQKVTGLQYKDRVTDSGHKLALEGIFVQIGLLPNTGWLDGAINRNRIGEIEIDARGETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTQA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaataacatgcagctccagttgaaagcctatctggaaaaattaaccaaacct
gttgagttagtggcgacgctggatgactcagccaaatccgccgaagttcgggaactgctg
accgacatcgccgggttgtccgacaaagtcagtttctttgaaaacaacgatctaccggtg
cgtaagccgtcgttcctgataaccaatccgggggcggccaacgggccgcgttttgccggc
gcgccgatgggacacgaatttacctcgctggtgctggcgttgctgcaaaccggtggtcac
ccgtcgaaagaagcgcaagaattactcgatcaaatccgcgagttggacggcaaattccac
tttgaaacctattactcgctgacctgccacaactgcccggatgtggtgcaggcgctgaat
ttaatgtccgttctgaacccgaacgtcacccacaccgcgattgacggcggcgtgtttcag
gatgagatcaaagaccgcaatatcatgggcgtgcccacggtattcctcaacggcgaacat
ttcggccagggccgcatgagcctggctgaaatcgtcggcaaggtagacaccggcgccaac
gcccgcgtggtcgacaaactgaacagccgcccggtgtatgacgtgctgatcgtcggcagc
ggcccggccggcgcggcagcggccgtgtacgcggcccgtaaggggatccgcaccggtctg
atgggcgagcgtttcggcggccagattctggataccgtcgatatcgaaaactacatttcg
gtgccgaagaccgaaggcgccaaactggcgaccgcgctgaaaactcacgtggacgactac
gacgtcgatgttatcgatttgcagagcgcgcaaaaactgattccggcgtctgaaccgggt
cagccgcaccagattgaaaccgtttccggcgcggtgctgaaatcccgcagcatcatcatt
gccaccggcgcgcgctggcgcaatatgaacgtgccgggcgaagatcagtatcgcacccgc
ggcgtgacctattgcccgcactgcgacggcccgctgttcaaaggtaagcacgtggcggtg
atcggcggcggcaactccggcgtggaagcggccatcgacctggcgggcgtggtgaaacac
gtgaccctgctggagttcgcgccggagctgaaagcggattcggtgttgcaggacaaactg
cgcagcctgccgaacgtggacgtgatcgtcaacgcccagaccaccgaagtcttgggcgac
ggtcagaaagtcactggcctgcagtacaaggatcgcgttactgacagcggtcataagctg
gcgctggaagggattttcgtgcagatcggcctgctgcccaataccggctggctggacggc
gcgattaatcgcaaccgcatcggtgaaatcgaaatcgatgcgcgcggcgaaaccagcgtg
aaaggcgtattcgcggcgggcgactgcaccaccgtgccttacaagcagatcatcattgcc
accggcgaaggggccaaagcttcgctgagcgcgtttgattatttgatcagaacccaggcg
taa

DBGET integrated database retrieval system