KEGG   Dickeya dianthicola: DDI_2222Help
Entry
DDI_2222          CDS       T05141                                 

Definition
(GenBank) Aldehyde dehydrogenase B
  KO
K00135  succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
ddq  Dickeya dianthicola
Pathway
ddq00250  Alanine, aspartate and glutamate metabolism
ddq00310  Lysine degradation
ddq00350  Tyrosine metabolism
ddq00650  Butanoate metabolism
ddq00760  Nicotinate and nicotinamide metabolism
ddq01100  Metabolic pathways
ddq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ddq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    DDI_2222
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DDI_2222
   00310 Lysine degradation
    DDI_2222
   00350 Tyrosine metabolism
    DDI_2222
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    DDI_2222
Enzymes [BR:ddq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     DDI_2222
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     DDI_2222
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     DDI_2222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Las1 DUF3813 DUF742 Lant_dehydr_C
Motif
Other DBs
NCBI-ProteinID: ATO33390
LinkDB All DBs
Position
complement(2253646..2255106)
Genome map
AA seq 486 aa AA seqDB search
MQLKNKTLFRQQSLIGGEWQDSFNGARLSVTNPATGTELGSIPLVTAEQTQQAITAAEQA
LSAWRQRTGKERAALMQAWAHLIRANQDDLAAILTAEQGKSLAEASGEIAYATSFIDWFA
EEAKRVEGSVLQSPQANQRLLVIKQGIGVCAAITPWNFPAAMITRKAAPALAAGCTMIIK
PAEQTPFTALALAELAQQAGIPAGVLQVVTGDAPAVGKVLCDSPVVRKLSFTGSTEVGRL
LMAQCAPTVKKLSLELGGNAPFIVFDDADLEQAIKGILASKFRNSGQTCVCANRIYVQRG
IYPALAARLVEEVEKLKVGDGTQPGVMQGPLIDQDAVGKVEQHIDDALSKGAELLTGGSR
HALGGTFFTPTVIGGVTRDMRFAREETFGPVAPLFPFDDEAQAVAMANDTEFGLAAYVYT
RDAIRQWRVPEALEYGMVGINTGLISNEVAPFGGVKQSGLGREGSRFGIEEYLEMKYLCV
DLTPSA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgcaactgaaaaataaaacgttattccgccagcaatctctgatcggcggcgaatggcag
gatagcttcaacggggcgcgtctgagcgtgaccaatcccgcgaccggtaccgagctggga
agcattccgctggtgacggcggagcagacccagcaggcgattaccgccgccgagcaggcg
ctgagcgcgtggcgccagcgcaccggcaaagagcgtgctgcgctgatgcaggcctgggcg
catttgattcgcgccaatcaggacgacctggcggcgattctaaccgccgaacagggcaaa
tcgctggcggaagccagcggtgaaatcgcctacgccacctcgtttatcgactggttcgcc
gaagaggccaagcgggtggaaggcagcgtgctgcaatcgccgcaggccaaccagcgcttg
ttggttatcaagcagggcatcggcgtgtgcgcggcgatcacgccgtggaacttcccggcg
gcgatgatcacccgcaaagccgcgccggcgctggcggccggctgcaccatgatcatcaag
ccggcggagcagacgccgtttaccgcgctggcgctggcggaactggcgcagcaggccggt
attcccgccggcgtgttgcaggtggtgaccggcgacgcgccggcggtgggtaaagtcctg
tgcgacagcccggtggtgcgcaagctgagtttcaccggttccaccgaagtcggccgcctt
ctgatggcgcaatgcgcgccgacggtgaaaaagctgtcgctggagctgggcggcaacgcg
ccgtttatcgtgtttgacgatgccgacctggagcaggcgataaaaggcattctggcgtct
aaattccgcaacagcggccagacctgcgtctgcgccaatcgcatttatgttcagcgcggc
atctatccggcgctggccgctcggctggtggaggaggtggaaaagctgaaagtgggcgac
ggcacccagcccggcgtgatgcaaggcccgctgatcgaccaggacgcggtcggcaaagtc
gagcagcatattgacgatgcgctgtcaaaaggggcggaactgctgaccggcggctcacgc
cacgcgctcggcggcaccttcttcaccccgacggtgataggcggcgtgacgcgcgacatg
cgtttcgcccgagaggagacgtttggcccggtggcgccgctgtttccgtttgacgatgag
gcgcaggcggtggcgatggccaacgataccgagttcggtctggccgcctacgtctacacc
cgcgacgctatccgccagtggcgagtgccggaagcgcttgaatacggcatggtggggatc
aacaccggcctcatttccaacgaagtagccccctttggcggggtaaaacagtcaggactg
gggcgtgaaggctcacgcttcggcatcgaggaatacctggagatgaaatatctctgcgtt
gacctcaccccttcagcctga

DBGET integrated database retrieval system