KEGG   Dickeya dianthicola: DDI_3085Help
Entry
DDI_3085          CDS       T05141                                 

Definition
(GenBank) Multimodular transpeptidase-transglycosylase
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
ddq  Dickeya dianthicola
Pathway
ddq00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ddq00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DDI_3085
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ddq01003]
    DDI_3085
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ddq01011]
    DDI_3085
Enzymes [BR:ddq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     DDI_3085
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     DDI_3085
Glycosyltransferases [BR:ddq01003]
 Polysaccharide
  Bacterial polysaccharide
   DDI_3085
Peptidoglycan biosynthesis and degradation proteins [BR:ddq01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   DDI_3085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly UB2H Transpeptidase UvrB_inter PBP1_TM
Motif
Other DBs
NCBI-ProteinID: ATO34253
LinkDB All DBs
Position
complement(3190994..3193327)
Genome map
AA seq 777 aa AA seqDB search
MSKRPRKKRRWLGWLIRLFLIFVVVMSIYGVYLDGEIRSRIDGKVWQLPAAVYGRMVNLE
PGMAYSKKEMVNLLEGMQYREVSRITRPGEFTVQANGIEILRRPFDFPDGKEGQIHAKMI
FSNDRLSQIQNMDNQRNFGFFRLDPKLITMLQSPNGEQRLFVQRSGFPDLLVQTLIATED
RHFYEHDGISFYSIGRALIANLTAGRAVQGGSTLTQQLVKNLFLTNERSLWRKANEAYMA
LIMDYRYSKDRILELYLNEVYLGQSGNDQIRGFPLASLYYFGRPVNELSLDQQAMLVGMV
KGASLYNPWRNPQVTLERRNLVLKLLQNQQVIDEDLYNMLSARPLGVQPKGGVISPQPAF
MQMVRQELQQRLGDKVNDLSGVKIFTTLDPVSQDAAEKAVEDGIPALRAARGVKDLESAM
VIVDRFSGEIRAMVGGSDAQFAGFNRAMQARRSVGSLAKPPTYLTALSMPDRYRLNTILA
DEPISLKQPNGTVWEPKNYDREFRGRVMLVDALTNSLNVPTVNLGMAVGLDQVSDTLQKL
GIPQNQIQAVPAMLLGAISLTPMEVAQEYQTIASGGNRASLSALRSVIAEDGKVLYQSFP
QAERAVPSQAAYLTLYGMQQVVERGTSRSLTVKFGNYHLAGKTGTTNDLRDSWFAGVDGK
EVAITWVGRDNNGPAKLTGANGALTIYRRYLENQTPLPLMLTPPEGITTMSVDGSGNLIC
NGSAGRALPVWTDNPQALCQASQPAVQQPANAPNGQPQQNQQEGGSVPDWIKQMFGQ
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagcggccgcgtaagaaacgccgctggctggggtggcttatccgtttgttcctg
atttttgtggtggtgatgtcgatttacggcgtttacctcgacggagaaattcgcagtcgc
atcgacggcaaagtgtggcaactgccggcggcggtgtatggccgcatggtcaaccttgag
ccgggcatggcctacagcaagaaagagatggtcaatctgctggaaggcatgcaataccgc
gaggtcagccgcattacccggccgggcgaattcacggtgcaggccaacggcatcgaaatt
ctgcgtcgtcctttcgacttcccggacggcaaggaaggccaaatccacgccaaaatgatc
ttcagcaatgaccggttgtcgcagatccagaatatggataatcagcgcaatttcggtttc
ttccggctcgatccgaaactgatcaccatgttgcagtcgccgaacggcgaacagcggctg
tttgtgcagcgttccggtttccccgacctgctggtgcaaacgctgatcgccaccgaagac
cgtcatttctacgagcatgacggcatcagtttctactccatcggccgcgcgctgatcgcc
aacctaacggccggccgggcggtgcagggcggcagtacgctgacccagcagctggtgaaa
aacctgttcctgaccaacgaacgctcgttatggcgtaaagctaacgaagcctacatggcg
ttgatcatggattaccgctacagcaaggatcgcattctggagctgtatctgaacgaggtg
tacctcggtcagagcggcaacgatcagatccgcggttttccgctggccagcctttactat
ttcggccggccggtcaacgagctgagcctcgaccagcaggcgatgctggtggggatggtg
aaaggggcgtcgctgtataacccgtggcgcaacccgcaggtgacgctggagcgccgtaat
ctggtgctgaaactgctgcaaaaccagcaggtcatcgacgaagatctttacaacatgttg
agcgcccgcccgctgggcgttcagccgaaaggcggggtgatcagcccgcagccggcgttt
atgcagatggtgcgccaggagttgcagcagcggctgggcgacaaggtcaacgatctgtcc
ggggtgaaaatcttcactacgctggatccggtgtcgcaggatgcggcggaaaaagcggtg
gaagacggcattccggcgctgcgcgcggcgcgcggcgtcaaggatctggaatcggcgatg
gtgattgtcgatcgcttcagcggtgagattcgggcgatggtaggcggttccgacgcccag
ttcgccggtttcaaccgcgctatgcaggcgcgccgttcggtcggttcgctggcgaaaccg
ccgacttacctgacggcgctcagcatgccggatcgctaccgcctcaacaccattctggcc
gatgagccgatttcgctcaaacagcccaacggcacggtctgggagccgaaaaactacgat
cgtgagttccgtggccgggtgatgctggtggacgcgctgacgaattcgctcaacgtgccg
acggtcaatctggggatggcggtcgggctggatcaggtcagcgatacattgcagaagctg
gggatcccgcaaaatcagattcaggcggtgccggcgatgttgctcggcgccatcagcctg
acgccgatggaagtggcgcaggaataccagactatcgccagcggcggcaaccgtgcgtcg
ttgtctgcgctgcgttcggtaatcgccgaagacggcaaggtgctgtatcagagcttcccg
caggccgaacgagccgtgccgtcacaggccgcctacctgacgttgtacggtatgcagcag
gtggtggagcgcggcacctcgcgctcgctgacggtgaaattcggcaattaccacctggcg
gggaaaaccggtaccaccaacgacctgcgcgacagctggtttgccggcgtcgacggcaag
gaagtggcgatcacctgggttggccgcgacaacaatggcccggcgaaactgaccggcgcc
aatggcgcgctgactatctatcgccgctatctggaaaaccagacgccgttgccgctgatg
ctgacgccgccggaaggcattaccaccatgtcggtggacggcagcggcaacttaatctgt
aacggcagcgccggccgggcattgccggtgtggaccgataacccgcaggcgttgtgtcag
gccagccagccagcggtgcaacagccggccaatgcgccgaatggtcagccgcaacaaaat
cagcaggaaggcggcagcgttcccgactggatcaagcagatgtttgggcagtaa

DBGET integrated database retrieval system