KEGG   Dickeya dianthicola: DDI_3850Help
Entry
DDI_3850          CDS       T05141                                 

Definition
(GenBank) Translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
ddq  Dickeya dianthicola
Brite
KEGG Orthology (KO) [BR:ddq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ddq03012]
    DDI_3850
   03029 Mitochondrial biogenesis [BR:ddq03029]
    DDI_3850
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ddq04147]
    DDI_3850
Translation factors [BR:ddq03012]
 Eukaryotic Type
  Elongation factors
   DDI_3850
 Prokaryotic Type
   DDI_3850
Mitochondrial biogenesis [BR:ddq03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    DDI_3850
Exosome [BR:ddq04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   DDI_3850
  Exosomal proteins of breast cancer cells
   DDI_3850
  Exosomal proteins of colorectal cancer cells
   DDI_3850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW Lsm_C
Motif
Other DBs
NCBI-ProteinID: ATO35018
LinkDB All DBs
Position
complement(3961518..3962702)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGQARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPVIRGSALKALE
GEAEWEAKIIELAEALDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIVKVG
EEVEIVGIKDTTKTTCTGVEMFRKLLDEGRAGENVGVLLRGTKRDEVERGQVLAKPGSIK
PHTQFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VNLIAPIAMDDGLRFAIREGGRTVGAGVVAKVIA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaaagaaaaatttgaacgtacaaaaccgcacgttaacgtcggtactatcggccac
gttgaccatggtaaaacaacgctgaccgctgccatcactaccgttctggcgaaaacctac
ggtggtcaggctcgtgcattcgaccagatcgacaacgcgccggaagaaaaagcgcgtggt
atcaccatcaacacctctcacgttgaatacgataccccgactcgtcactacgcacacgtt
gactgcccgggacacgccgactatgtgaaaaacatgatcaccggtgctgcccagatggac
ggtgcgatcctggtcgttgcagcgactgacggcccgatgccgcagacccgtgagcacatc
ctgctgggtcgccaggtaggcgttccgtacatcatcgtgttcctgaacaaatgtgacatg
gttgatgacgaagagctgctggaactggttgagatggaagtgcgtgagctgctgtctcag
tacgatttcccgggcgacgacacgccggttatccgcggttccgcgctgaaagcgctggaa
ggcgaagccgagtgggaagcgaaaatcatcgaactggccgaagcgctggacagctacatt
ccggaaccggagcgcgcgattgacaagccgttcctgctgccgatcgaagacgtattctcc
atctccgggcgtggtacggtagtaaccggtcgtgtagagcgcggcatcgttaaagtgggt
gaagaagttgaaatcgtgggtatcaaagacaccacgaaaaccacctgtaccggtgttgaa
atgttccgcaaactgctggacgaaggccgtgcgggcgagaacgtgggtgttctgctgcgt
ggtaccaagcgtgatgaagtggagcgtggtcaggtactggccaagccgggctcgatcaag
ccgcacactcagttcgaatctgaagtgtatattctgagcaaagacgaaggtggccgtcac
acgccgttcttcaaaggctaccgtccgcagttctacttccgtaccactgacgtgacaggt
accatcgaactgccggaaggcgtagaaatggtcatgccgggcgacaacatcaagatggtc
gtaaacctgatcgcgccgatcgcgatggacgacggtctgcgtttcgctatccgtgaaggc
ggccgtacagtaggcgccggcgtggttgccaaagttatcgcttaa

DBGET integrated database retrieval system