KEGG   Dickeya dianthicola: DDI_3938Help
Entry
DDI_3938          CDS       T05141                                 

Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ddq  Dickeya dianthicola
Pathway
ddq00564  Glycerophospholipid metabolism
ddq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ddq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DDI_3938
Enzymes [BR:ddq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     DDI_3938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 FAD_binding_2 NAD_binding_8 3HCDH_N FAD_oxidored Lycopene_cycl GIDA HI0933_like
Motif
Other DBs
NCBI-ProteinID: ATO35106
UniProt: A0A2D1JYZ7
LinkDB All DBs
Position
4052137..4053636
Genome map
AA seq 499 aa AA seqDB search
METKDLIVIGGGINGTGIAADAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVGEALSEREVLLKMAPHIIFPMRFRLPHQPHLRPAWMIRAGLFMYDHLGKRVSLPSS
HGLRFGHESVLKPELTRGFEYSDCWVDDARLVVLNAQEVVRRGGEVKTRMKVTRARRENG
LWVVEAEDTLSGETHRWQAKGLVNATGPWVRQFFDDGLALPSPYGIRLIKGSHIVVPHVH
QETQAYILQNKDHRIVFVIPWQDEFSIIGTTDVEYHGDPHQVKIDDNEIRYLLDVYNDHF
KKQLTRDDIVWTYSGVRPLCDDESDSPQAITRDYTLSVADESGKAPLLSVFGGKLTTYRK
LAEHAMDKLVKYYPQAGQAWTRNAILPGGDISGSREDYAAALRRRYNLPEALVRRYSRTY
GSQSEKILGNAQAPNDLGEHFGHTLYEAELRYLVEHEWVVSLDDAIWRRTKLGMWLDDAQ
QQRVAEWLTSYRSQLAKAG
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagatctgatcgtgatcggcggaggcattaacggtaccggcatcgcagcg
gatgccgccgggcgcggactgtccgtcctgttgctggaagcacaggatctggcctgcgcc
acctcttccgccagctcaaagctgattcacggcggcctgcgctatctggagcactacgag
ttccggctggtgggagaagccttgtccgaacgcgaagtgctgctgaaaatggcaccgcac
atcattttcccgatgcgttttcgcctgccgcaccagccgcatctgcgcccggcctggatg
attcgcgccggtctgttcatgtatgaccatctgggtaaacgcgttagcctgccgtccagt
cacgggctgcgattcggccatgaatcggtgctgaaacctgaactgacgcgcggtttcgaa
tattccgactgctgggtagacgatgcccgtctggtggtgctgaacgcgcaggaagtggtg
cgccgcggcggcgaggtgaaaacgcgcatgaaagtcacccgcgcccgccgcgaaaacggc
ctgtgggtggtggaagccgaagacacactgagcggtgagactcatcgctggcaggcgaaa
gggctggtcaacgccaccggcccgtgggtacgccagttctttgacgatggtctggcgctg
ccgtcgccgtacggcatccgactgatcaaaggcagccatatcgtggtcccgcacgtgcat
caggaaacgcaggcctacattttgcaaaacaaagaccaccgcatcgtgtttgtgattccg
tggcaggatgaattttccatcatcggcaccaccgatgtggagtaccacggcgatccgcat
caggtgaagattgacgacaacgaaattcgttacctgctggacgtatacaacgatcacttc
aaaaaacagctgacgcgcgacgacatcgtctggacctattcgggcgtgcgcccgctgtgc
gacgacgaatcggattcgccgcaggccatcacccgcgattacacgctgtcagtggcggat
gaaagcggtaaagccccgctgctgtcggtgttcggcggcaagctgaccacctatcgcaaa
ttagccgaacacgcaatggataagctggtgaagtactatccgcaggcaggccaggcctgg
acccgcaacgctattctgcccggcggcgacatcagcggcagccgcgaagattatgccgca
gcattgcgtcgccgttacaatctgccggaagcgctggtgcgccgttacagccgcacctac
ggcagccagagcgagaaaatcctcggcaacgcgcaggcgccgaacgacttgggtgaacat
ttcggccataccttgtacgaagccgagctgcgttatctggtggaacacgaatgggtggtg
tcgctggacgacgctatctggcgccgcaccaaactgggcatgtggctggatgacgcccag
cagcagcgcgtcgccgaatggcttaccagctaccgcagtcagttagccaaagcgggttaa

DBGET integrated database retrieval system