KEGG   Dickeya dianthicola: DDI_4267Help
Entry
DDI_4267          CDS       T05141                                 

Definition
(GenBank) 3-oxoacyl-[ACP] synthase
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
ddq  Dickeya dianthicola
Pathway
ddq00061  Fatty acid biosynthesis
ddq00780  Biotin metabolism
ddq01100  Metabolic pathways
ddq01212  Fatty acid metabolism
Module
ddq_M00083  Fatty acid biosynthesis, elongation
ddq_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:ddq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DDI_4267
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    DDI_4267
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ddq01004]
    DDI_4267
Enzymes [BR:ddq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     DDI_4267
Lipid biosynthesis proteins [BR:ddq01004]
 Fatty acid synthase
  Component type
   DDI_4267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N
Motif
Other DBs
NCBI-ProteinID: ATO35435
LinkDB All DBs
Position
4402955..4404184
Genome map
AA seq 409 aa AA seqDB search
MRRVVVTGMGGVTAFGDGWGQVAGGLLAGRNAVRHMPEWQVYDGLNTLLGAPVDDFQLPE
HYTRKRIRSMGRVSLMATRATELALEQAGLLGHSVLTNGETGIAYGSSTGSTGPVSEFAT
MLTEKHTNNITGTTYVQMMPHTTAVNAGLFFGLRGRVIPTSSACTSGSQAIGYAWEAIRH
GYQTVMVAGGAEELCPSEAAVFDTLFATSQRNDAPETTPAPFDAGRDGLVIGEGAGTLIL
EELEHAQARGATIYAELVGFYTNCDAAHITQPQRETMQVCIEGALRVAGLTPADIGYINA
HGTATDRGDVAESQATAAIFGNTTPISSLKSYFGHTLGACGSLEAWMSIEMMRAGWFAPT
LNLRQPAEDCGDLDYIIGEPRQLDVKYIQSNNFAFGGINTSLIFRRWPS
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgtgtggttgtgacaggaatgggcggcgtcaccgcatttggcgacggctggggt
caggttgccggtgggttgctggcgggccgcaacgcggtgcgccacatgccggaatggcag
gtttatgacggcctgaacacgttactgggcgcgccggtcgatgatttccaattgccggag
cattatacccgtaaacgaatccgctcgatggggcgggtgtcgctgatggcgacccgggcg
acggagctggcgctggagcaggccgggctgctgggccattcggtgctcaccaatggcgaa
accggcatcgcttacggttcgtccaccggcagcaccggcccggtcagcgaattcgccact
atgctgacggaaaagcacaccaacaatattaccggcaccacctatgtgcagatgatgccg
cacaccaccgcggtgaacgccgggctgttttttggcctgcgcgggcgggtgattcccacc
tccagcgcctgtacctcgggcagtcaggcgataggctatgcctgggaagcgatccggcac
ggttatcaaaccgtgatggtggccggcggcgccgaggagctgtgcccgtcggaggcggcg
gttttcgatacgctgttcgccaccagtcagcgcaatgatgcgccggaaaccacgccggcg
ccgtttgatgccggccgagacggtttggtgattggcgaaggcgcagggacgttgattctg
gaagaactggagcacgcgcaggcgcgcggcgctaccatttacgccgaactggtgggtttt
tacaccaactgcgacgcggcgcatattacccagccgcagcgtgaaaccatgcaggtttgt
attgaaggcgcactgcgggtggccgggttaacgcccgccgatatcgggtatatcaacgcg
catggtacggctaccgatcggggcgatgtggcggaaagccaggcgacggcggcaattttt
ggcaacaccacgccaatttcctcgctgaagagctattttggacacacgctgggcgcttgc
ggttcgctggaagcctggatgtcgatagagatgatgcgtgccggctggttcgcacccacg
ctgaatctgcgccagccagcggaagattgcggcgatctggattacatcatcggtgaaccc
cgacagcttgacgtgaagtatattcagtctaacaactttgcctttggcggtatcaacacc
tcgctgattttccggcgctggccgtcatag

DBGET integrated database retrieval system