KEGG   Dickeya dianthicola: DDI_4290Help
Entry
DDI_4290          CDS       T05141                                 

Definition
(GenBank) Polymyxin resistance protein ArnC, glucosyl transferase
  KO
K10012  undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase [EC:2.4.2.53]
Organism
ddq  Dickeya dianthicola
Pathway
ddq00520  Amino sugar and nucleotide sugar metabolism
ddq01100  Metabolic pathways
ddq01503  Cationic antimicrobial peptide (CAMP) resistance
Module
ddq_M00761  Undecaprenylphosphate alpha-L-Ara4N biosynthesis, UDP-GlcA => undecaprenyl phosphate alpha-L-Ara4N
Brite
KEGG Orthology (KO) [BR:ddq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    DDI_4290
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    DDI_4290
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:ddq01005]
    DDI_4290
Enzymes [BR:ddq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.53  undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase
     DDI_4290
Lipopolysaccharide biosynthesis proteins [BR:ddq01005]
 Unusual sugar
  DDI_4290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_2 Glyco_tranf_2_4
Motif
Other DBs
NCBI-ProteinID: ATO35458
LinkDB All DBs
Position
4426246..4427250
Genome map
AA seq 334 aa AA seqDB search
MLHRETLHSNVEAINKVSVVIPVFNEQESLPELIRRTTAACDQMNRDYEILLVDDGSSDN
SAALLTKAAQVPGSHVVAVILNRNYGQHSAIMAGFSHVSGDLVITLDADLQNPPEEIPRL
VDTADQGYDVVGTIRENRQDSWFRKSASRMINHLIQRTTGKAMNDYGCMLRAYRRHIIDA
MMHCHERSTFIPILANTFARRTTEIMVRHSEREFGDSKYSFMKLINLMYDLVTCLTTTPL
RLLSMVGSVIALSGFTLALLLILLRLFFGAAWAADGVFTLFAVLFSFIGAQFVGMGLLGE
YIGRIYNDVRARPRYFIQRIVSHDPRFSEQDNEE
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgttacacagggaaaccctccattcaaacgtggaagccatcaataaagtctcggtggtg
attccagttttcaacgagcaggagagcctgccggagctgattcgtcgtaccaccgccgcc
tgtgatcaaatgaatcgtgattatgaaattctgctggtggacgacggcagcagcgacaac
tcggccgcgttgctgaccaaagcggcgcaggtgccgggcagccatgtggtcgcggtgatc
ctcaaccgtaactacgggcagcattcggcgatcatggccgggttcagccatgtgtccggc
gatttggtcatcacgctggatgccgacctgcaaaacccgccggaagaaattccccggctg
gtggacacggcggatcaagggtatgacgtggtgggcaccatccgtgaaaatcgtcaggac
agctggtttcgtaaatccgcttcgcgcatgatcaaccacctgattcagcgcaccaccggc
aaggccatgaacgattacggctgtatgctgcgcgcttatcgccgtcatatcatcgacgcc
atgatgcattgccatgagcgcagcacctttatcccgatcctcgccaatacgtttgcccgt
cgcaccaccgaaattatggtgcgccattccgagcgcgaatttggcgattccaaatacagc
ttcatgaagctgattaacctgatgtacgacctggtgacctgcctgaccaccacgccgctg
cgtttgctgagcatggtgggcagcgtgattgcgctctccggtttcacgctggcgctgctg
ctgatcctgctgcgcctgtttttcggcgcggcctgggcggcggacggggtgtttacgctg
ttcgccgtgctgttctcttttatcggcgcccagttcgtcggtatggggctactgggtgaa
tatatcggacgaatttacaacgatgtccgcgcccgtccccgttattttattcaacgtatt
gttagccatgatccacgattttctgaacaggacaatgaagaatga

DBGET integrated database retrieval system