KEGG   Deinococcus deserti: Deide_00131Help
Entry
Deide_00131       CDS       T00880                                 

Definition
(GenBank) putative Serine/threonine protein kinase
  KO
K08884  serine/threonine protein kinase, bacterial [EC:2.7.11.1]
Organism
ddr  Deinococcus deserti
Brite
KEGG Orthology (KO) [BR:ddr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ddr01001]
    Deide_00131
Enzymes [BR:ddr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Deide_00131
Protein kinases [BR:ddr01001]
 Serine/threonine kinases: Other
  Bacterial family
   Deide_00131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr DUF4726 Kdo
Motif
Other DBs
NCBI-ProteinID: ACO44811
UniProt: C1CXK5
LinkDB All DBs
Position
complement(13737..14726)
Genome map
AA seq 329 aa AA seqDB search
MTPERTIPGYSLLRPLGRGNTSLVYLAAAEDARYVALKIPHEHTLKEKEAAERFGNEVRL
TLQFRHPHIVHAYAGTAFGTQAFLALKFYRQGDLTKQLADLPSGQRLPEPTALRILADVA
SALTYLHHLDAVHQDVKPQNVYVHDGRAALGDMGSAFFMSQGGKVSGSPFYMAPEIYHGE
SSSGASDVYSLGVMMYELLTGVRPFTGSSYEELMVAHLTRFPRSIAHLNSNVDRRVSRLA
ELALAKRPHERPSADELRRALLESLGELPQDEIYEECPDTPEVVAVGRKVGRHRPAPAAG
PAPLPPPDPAAADKDIDRSSRWKLFRRRK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgactccagaacgtactattcccggctatagccttctgcgccctctgggacgtggtaat
acctcgctggtgtatctggctgcagccgaggatgcccgttatgtggcactcaaaatccca
cacgagcacacgcttaaggagaaggaggcagccgaacggtttgggaatgaggttcgactg
accctgcaattccggcaccctcatattgtccatgcctatgctggaactgcctttggtacg
caggctttcctggccctcaaattctaccggcagggagatctgaccaaacagttagcggat
ctgccttctggccagcgtctacccgagcccacagccttgcgaatcctggctgacgttgcc
tctgccctgacgtatctgcatcatctggacgcagtgcatcaggacgtcaaacctcagaac
gtatatgtgcatgacggccgtgcggctctgggtgacatgggcagtgccttctttatgtcc
caaggcggcaaggtaagtggcagtccattttatatggcgcccgagatttatcacggcgaa
agcagtagtggagccagcgacgtatacagcctgggtgtcatgatgtacgagttgctgaca
ggtgttaggccatttactggcagcagttacgaggagctgatggtcgcccatctgacccgc
tttccacggtccattgctcacctgaacagtaatgttgaccgccgggtctcccggctggca
gaactggccttggccaagcggccccacgagcggcccagcgccgacgagttgcggcgtgcc
ctccttgaatcgcttggtgagttgccgcaagacgaaatttatgaagagtgcccagatact
cccgaagttgtcgctgttggcaggaaggtaggccgccacaggcctgctccggcggctggt
cctgcacccctaccccctcctgatccagctgcagccgacaaggatatcgacagatccagc
cgctggaagctgttcagacgccggaaataa

DBGET integrated database retrieval system