KEGG   Deinococcus deserti: Deide_08820Help
Entry
Deide_08820       CDS       T00880                                 

Definition
(GenBank) putative Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ddr  Deinococcus deserti
Pathway
ddr00620  Pyruvate metabolism
ddr00680  Methane metabolism
ddr01100  Metabolic pathways
ddr01120  Microbial metabolism in diverse environments
ddr01200  Carbon metabolism
Module
ddr_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ddr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Deide_08820
  09102 Energy metabolism
   00680 Methane metabolism
    Deide_08820
Enzymes [BR:ddr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Deide_08820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase HAMP PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ACO45758
UniProt: C1D1N4
LinkDB All DBs
Position
complement(1072693..1075179)
Genome map
AA seq 828 aa AA seqDB search
MGIRSDVNLLGRTLGQVLKEQEGEAFFELVERTRALVREVRAGGDDTELSAMLAELSGAE
AGRLARAFTWYFQLVNLAEEYERVRVLSSVEGVRPQSLEQALMDLKAQGMSAQEVEALLS
RLDLGLTFTAHPTEMRRRTVRGHLVEVARAIPELSQPTLAEDATERIAAHVEAMWSTPEL
RRLKPTVLDEVKGGLSYMPNIARALPMLQRDLSRAFERVYGHSSEAQLPLSFTSWMGGDR
DGNPFVTPQATHDALALHRERAREVLISSIAQAYADLSQEKEGQEPYRQELRALHNAVRD
GEPVELLPRLEALHRRLCAEGQRRSADQLLTPLLTVARVFGQHLVSLDIREHSAQTGAAV
AALLKAAGVENDYEALAEHARQEVLTRELRSRRPLWPAGEPFPETLETAIGPIRQVQAAT
RQVGPRAFGRYIVSMAESVSDVLEPLILAREVGFRALPVPLFETLDDLQRAPQVVWELLS
IPEYRAALGSDVQEIMLGYSDSNKDAGFLAANWALHEAQRAISEVCRRAGVRWRFFHGRG
TSIGRGGGPASRAILGQPAGTIDAGLRITEQGEALADKYSHPVLARRNLEQALYGVLLAA
ARPAVAPPEAWTRGMDTAARASAAAYRALVDDPGFLPFFEAVTPIHEIARLNIASRPVRR
PGAPTLGNLRAIPWVMCWTQNRANLPGWYGLHEGLSTLGVDLAREMYRDWPFFRTVLDNA
QMSLAKSDPLIFDEYLRLMGEHPLATQLKAAYQATVALVQDVVGAPLMAGEPRLKESIAL
RNPYIDPIHRIQVELLRRSRSKEGGLDEFEVPLLLSIQGIAAGVRNTG
NT seq 2487 nt NT seq  +upstreamnt  +downstreamnt
atggggattcgcagtgacgtgaacctgctgggcagaacgctcgggcaggttttgaaagag
caggagggcgaggccttcttcgaactggtggagcgcacgcgcgccctggtgcgcgaggtc
cgcgcgggaggtgacgacaccgaactgagcgccatgctcgcggagctctccggggccgag
gccgggcggctggcccgggccttcacgtggtatttccagctggtcaacctggccgaggaa
tacgagcgggtgcgggtgctcagcagcgtagagggtgtcaggccccagagtctggagcag
gccctgatggatctcaaagcgcagggcatgagtgcccaggaggtcgaggcgctgctgtcg
cggctggacctgggtctgaccttcacggctcaccccaccgagatgcgccgccgcaccgtg
cgcggtcacctggttgaagtcgcgcgcgccattcccgagctgagccagcccacgctggcc
gaggacgccaccgagcggattgccgcccatgtggaggccatgtggtctaccccggagctt
cgccgcctgaaacccaccgttctggacgaggtcaagggcggtctgagctacatgcccaac
atcgcgcgggcactgccgatgctgcaacgcgacctgtcgcgcgccttcgaaagggtgtac
gggcacagcagcgaggcgcagctgccgctgagcttcacctcctggatgggcggagaccgc
gacggcaaccccttcgtgactccgcaggccacccacgacgccctggcgcttcaccgcgag
cgggcccgcgaggtgctgatctccagcattgcgcaggcctacgcggacctcagccaggaa
aaggagggccaggagccttaccgtcaggaactccgcgccctgcataacgctgtgcgcgac
ggcgaaccggtagaactgctgccgcgcctggaagcgctgcaccggcgtctgtgcgccgaa
gggcagcggcgcagcgccgatcagctgctgacgccgctgctgacggtagcgcgggtcttc
gggcagcacctggtcagcctggacatccgtgagcactccgcgcagaccggcgcagctgtg
gccgcgctgctcaaggctgcaggcgtggagaacgactacgaggcgctggccgagcatgcc
cggcaggaggtgctgacccgcgagttgcgttcccgccgcccgctgtggcctgccggtgag
ccgttccccgagacgctcgaaaccgccatcgggcccatccggcaggtgcaggccgcgacc
cggcaggtgggcccccgcgctttcggacggtacatcgtcagcatggccgagagcgtcagc
gatgtcctcgaacccctgatcctggcccgcgaggtaggcttccgggccctgccggtgccg
ctgttcgagaccctggatgacctgcagcgcgccccacaggtggtctgggagctgctgagc
attcctgagtaccgcgccgcactgggcagcgacgttcaggagatcatgctgggctacagc
gacagcaacaaggacgcgggcttcctggcggccaactgggcgctgcacgaggcgcagcgt
gccatcagtgaggtgtgccggcgtgccggcgtgcgctggcgcttttttcatgggcgcggc
accagcatcgggcgcggcggcggcccggcgtcgcgggccatcctgggacagccggccggc
accatcgacgcggggctgcgcattaccgagcagggcgaggcgctggctgacaagtacagc
catccggtcctggcacggcgcaatctggagcaggccctctacggggtgctgctggcggcc
gcgcgtccggcagtggctccgccggaggcctggacccgtggcatggacacagcggccagg
gccagcgcggctgcgtaccgcgccctggtggacgacccgggcttcctgccctttttcgag
gcggtcacgccgattcacgagattgcccgcctgaacatcgcttcgcgtccggtccggcgg
cccggtgcgccgaccctggggaacctgcgggccattccctgggtcatgtgctggacccag
aaccgggccaacctgcctggctggtacggcctgcacgagggtctcagcaccctgggcgtg
gatctggcccgcgagatgtaccgggactggccctttttccgtaccgtgctggacaacgcc
cagatgagtctggccaagagcgatccgctgattttcgacgagtacctgcgcttgatgggc
gagcatccactggccacgcaactcaaggcggcctatcaggccacggtggccctggtgcag
gacgtggtgggcgcaccgctgatggccggcgagccgcgtctgaaagaaagcatcgccctg
cgcaacccctacattgacccgattcaccggattcaggttgagctgcttcgccgcagccgc
agcaaggaaggcggcctggacgagttcgaggtcccactgctgctcagtattcagggcatc
gcggcgggcgtgcgcaacaccggctga

DBGET integrated database retrieval system