KEGG   Deinococcus deserti: Deide_2p00210Help
Entry
Deide_2p00210     CDS       T00880                                 

Definition
(GenBank) putative glycerol-3-phosphate dehydrogenase, putative glycerol-3-phosphate oxidase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ddr  Deinococcus deserti
Pathway
ddr00564  Glycerophospholipid metabolism
ddr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ddr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Deide_2p00210
Enzymes [BR:ddr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Deide_2p00210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored NAD_binding_8 GIDA HI0933_like Pyr_redox_2 FAD_binding_3 Pyr_redox_3 Thi4
Motif
Other DBs
NCBI-ProteinID: ACO47676
UniProt: C1D2N7
LinkDB All DBs
Position
p2:complement(26917..28488)
Genome map
AA seq 523 aa AA seqDB search
MTKPADPRSESLRDATQPHTWDLLVIGGGASGLGTALDAASRGYRTLLLEAHDYAKGTSS
RSTKLVHGGVRYLAQGNVSLVREALHERGLMRRNAPHLVRDQGFVVAAYRWWSAPFYGVG
LKMYDLLAGSLGLGSSRFVSAAEALRRIPTLQKTALKGGILYFDGQFDDARMAVTLLRTF
QNFGGVALNHAPVTGLIHDSGRVTGARFRDTETGQDHEVRARAVVNATGVFVDDIRRMED
PLVEPMLSPSQGVHVVVDRRFLPADTAIMVPRTDDGRVLFAVPWHDHVVIGTTDTPVPQT
SHEPRALPQEVDFILRTAAQYMDPAPTRADVRSVFAGLRPLVKAAGGTDTKALSRDHVIR
ISGGGLITLTGGKWTTYRRMGEDTVNRAAELAGLPQRLSLTQALKLHGAFRESPESQVPD
SHWKVYGTDASRIQALPGAQAALHPSLPYTEAEVQWAVRHEQARTVEDVLARRLRALLLD
AQASIEAAPRVAALLAEELGQDAEWQAGQIQAYTTLAQGYVLA
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaacctgccgacccccgatcagagagcctgcgcgacgctactcagccccacacc
tgggacctgctggttattggtgggggagcctccggactgggcactgctctggacgcagcg
agccgtggttaccgcacgctgctgctcgaagcccacgactacgccaaaggcaccagcagc
cgcagcaccaagctcgttcacggcggcgtgcgctacctggctcagggcaacgtctcgctg
gtccgtgaggccctgcatgagcgggggctgatgcgccgaaacgccccacaccttgtgcgg
gatcagggttttgttgtggccgcctaccggtggtggtcagcgccgttttatggcgttggg
ttgaagatgtacgacctgctggccggctcactcgggctgggcagcagccgctttgtcagt
gctgccgaagccttgcgccgcattcccacccttcagaaaacagcgctgaagggcggcatc
ctgtatttcgacggccagtttgacgatgcccgcatggccgttaccctgttgcggacgttc
cagaattttggcggagtcgcgctgaaccatgcgcccgtgaccgggttgattcacgacagc
ggcagggtcacgggggcccggttccgcgataccgagaccggccaggaccacgaggtccgc
gcccgcgccgtcgtaaatgccactggcgtgttcgttgacgatatccgccggatggaggac
cctctcgtcgaaccgatgctctcacccagccagggtgttcatgtggtggtcgaccggcga
ttcctgcccgcggacaccgccatcatggttccccgcaccgatgacgggcgcgtgctgttc
gcggttccctggcacgatcatgtggtgatcggcaccaccgacactccggtcccgcagacc
agccacgagccgcgcgccctgccgcaggaagttgactttattctgcgtacagcagctcaa
tacatggatcccgcacccacccgcgccgatgtccgcagcgtgttcgctggtcttcgcccg
ctggtcaaagctgccggcggcaccgataccaaggccctgtcgcgtgaccatgtgatccgg
atcagcggtggcggactgatcaccctgaccggcggaaaatggaccacctaccgccgcatg
ggcgaagacaccgtcaaccgcgccgctgagcttgcgggtctgccccagcgtctcagcctg
acgcaggccctgaaacttcatggtgcattccgtgaatctccggagagccaggtgcctgac
agtcactggaaggtgtacggcacggacgccagccggattcaggcgctgcccggcgcgcag
gcggcccttcatccaagccttccctatacggaggctgaagtccaatgggctgtccggcat
gagcaggcgcgcaccgtcgaggatgtgctggcgcgccgtctgcgtgcgctgctgctggac
gcccaggccagcatcgaggcggcgccgcgtgtagcagctctcctggccgaggagctgggc
caggatgcggagtggcaggctggacagattcaggcttacacgacgctggctcaaggatat
gtcctggcctga

DBGET integrated database retrieval system