KEGG   Desulfovibrio desulfuricans ATCC 27774: Ddes_0171Help
Entry
Ddes_0171         CDS       T00837                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
dds  Desulfovibrio desulfuricans ATCC 27774
Pathway
dds00473  D-Alanine metabolism
dds01100  Metabolic pathways
dds01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:dds00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Ddes_0171
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Ddes_0171
Enzymes [BR:dds01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Ddes_0171
Peptidoglycan biosynthesis and degradation proteins [BR:dds01011]
 Precursor biosynthesis
  Racemase
   Ddes_0171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ACL48091
UniProt: B8J2K3
LinkDB All DBs
Position
213021..214136
Genome map
AA seq 371 aa AA seqDB search
MVSFDRPVWAEIDLSAFRHNMRQIKSLLQPGTIFCPIIKADGYGHGAVPLAHEAVAMGAG
YLGVAILDEAAALRAAGITLPILILGYTPPQAAAFVVSNHITQTIFSKEQADALSAAASN
LGITVKVHVKVDTGMTRIGVRPEEAAAFCSYVAGLENVHLEGMFTHFASSDSADHAYCLE
QFGRFTAAIAAVEASGIRLGIRHCANSAAILSLPEGHLDMVRAGIILYGLKPSDECPMPI
DLRPVMRLKARLAMVKQVPPGVGVSYGSIYHTQKESSLATIPIGYADGYTRMLSRKAQVL
LRGQRAPVVGRICMDQCMVDVSHVPQAAVGDEVLLFGGPDLPADEIAAHLGTINYEVVCM
VGKRVPRVYVE
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
gtggtcagttttgacaggcccgtgtgggcagaaatagatctttcggcctttcgccataat
atgcggcagatcaagtcgcttcttcagccaggcacaatcttttgccccattatcaaggct
gacggctacggccacggagccgtgcctctggcgcatgaggcagtagccatgggggcgggc
tacctcggcgtggctattctggacgaggccgcggccctgcgcgcggcgggcataaccctg
cccattctcattctcggctatacgccgccccaggctgctgcctttgtggtcagtaaccac
attacccagaccattttcagcaaggaacaggccgatgccctgtctgccgcggccagtaac
ctgggcatcaccgtcaaggttcacgtcaaggtggataccggcatgaccagaatcggcgtg
cggcccgaagaggctgcggcgttctgctcatatgtggccggacttgaaaacgtgcatctt
gaaggcatgttcacgcactttgccagttccgacagcgccgaccatgcgtactgtcttgag
cagttcgggcggtttacggcggccattgccgctgtggaggcctcgggcattcgactaggc
atccggcactgtgccaacagcgccgccatattgtccctgcctgaaggtcatcttgatatg
gtccgggcagggataattctttatggcctcaagccgtccgacgaatgccccatgcccatt
gatctgcgtcccgtcatgcgcctcaaggcgcggctggccatggtcaagcaggttccgccc
ggcgtgggcgtgagctacggcagcatctatcacacgcagaaagaaagcagccttgccacc
atccccattggctatgctgacggatacacgcgcatgctgagccgcaaggcgcaggtgctg
ctgcgtgggcagcgtgccccggtggtgggccgtatatgtatggaccagtgcatggtggat
gtgagccatgtgccgcaggccgccgtgggcgacgaggtgcttcttttcggcgggcctgat
ctgcccgcagatgaaattgccgcccatctgggtactatcaactatgaagttgtctgcatg
gtgggcaaacgtgtgccaagggtatacgtggagtaa

DBGET integrated database retrieval system