KEGG   Desulfovibrio desulfuricans ATCC 27774: Ddes_1521Help
Entry
Ddes_1521         CDS       T00837                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase, anaerobic, A subunit
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
dds  Desulfovibrio desulfuricans ATCC 27774
Pathway
dds00564  Glycerophospholipid metabolism
dds01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dds00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Ddes_1521
Enzymes [BR:dds01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Ddes_1521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 Pyr_redox_2 DAO_C FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ACL49423
UniProt: B8J0Z6
LinkDB All DBs
Position
complement(1817423..1819030)
Genome map
AA seq 535 aa AA seqDB search
MLETTVVVIGGGATGIGALRDLCMRGIPAILLEQGGIAHGTSSRFHGLLHSGARYVVNDN
ESARECIEENMIVRRIGRQCVEETEGFFALTPQDDPAYVEKFVAGCREAGIDAQEIEVAE
ALRLEPNLSPEVRRVFRVPDSCVDGFRLVLHNAMSARRHGGRMLTYHEATAITLRNGRVC
GVTAVDRHTGATVEIACQCVINAAGSWAGRIAGMAGLDVALSPDRGTLVVFNHRFTSRVI
NRLHPSGDGDIFVPHGSITILGTTSASTDRPDDTTPTTEEVLRLLDIGEPLFPQVRQYRI
LRAFAGTRPLYTPGGAAGRKASRNFHIVDHADEGLEGMVSIFGGKLTTYRLMAERVVDRV
CAKLGHSAVCRTATEALVPDADEATLKRAARFFPMQGLNLMADRLGDDLPSVLELAEQQA
GNPLICECEMVSLAEIEYVARQPATYSLTDIRLRTRLGMGTCQGAFCSLRTVGALAEHGV
QLELTPTDNVRRFLQERWGGLRFALWGMQAREMELSRAIYATTLNLDGAAHEQDR
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgctggaaacaaccgttgtagtcattggaggcggcgcgaccggtattggtgcgctgcga
gacctgtgcatgcggggaattcccgccattctgcttgagcaggggggcatcgcccacggc
accagctcacgctttcatggtctgctgcacagcggagcgcgctatgtcgtcaatgacaat
gaatccgcccgggaatgtattgaggaaaatatgatcgtgcgtcgtatcggcagacaatgc
gttgaggaaaccgaagggttcttcgcgcttacgccgcaggacgaccccgcatatgttgaa
aaatttgtggctggctgtcgcgaggcaggcattgacgcgcaagaaattgaagttgccgag
gccttgcggctggagccgaatctttcgcctgaggtccgccgggtttttcgtgtgcccgat
tcctgtgtagacggttttcgcctggtgctgcataacgccatgtcggcccggcgccatggc
gggcgcatgctcacctatcatgaggccaccgccataacgctgcgcaatggccgtgtatgc
ggtgtcacagccgttgatcgccataccggggcaacagttgaaatcgcctgtcagtgcgtc
atcaatgcggccggctcgtgggccgggcgcatcgcgggcatggcgggccttgatgtggcg
ctttcgcccgacaggggaacgctggtggttttcaaccaccgttttacctccagagtcatc
aaccgtctgcatcccagtggcgacggggatatttttgtgccgcatggttccatcaccatt
ctcggcaccacatccgcgtccaccgacagaccggacgacaccacgcctacaactgaagag
gtgctgcgtctgcttgatatcggcgaaccgctttttccccaggtgcgccagtaccgcatt
ctgcgtgcctttgccggcacacgcccgttgtataccccgggcggagcggcagggcgcaag
gccagccgtaattttcatattgtggatcatgcggatgagggccttgagggcatggtcagt
attttcggtggcaaacttaccacctaccgtcttatggctgagcgggttgttgacagggtt
tgcgccaagctggggcatagtgctgtctgccgcacggctacagaagcccttgtgccggac
gcggacgaagctacgctcaaacgggcggcccgcttttttcccatgcagggcctgaatctc
atggccgaccggcttggtgatgaccttccgtcagtgctggaactggccgagcagcaggcg
ggcaatccgctgatctgcgaatgcgaaatggtgagcctggctgaaattgaatatgtggcg
cgccagcctgccacatattctcttactgacatacgcttgcgtacgcgccttggcatggga
acctgccagggagcgttttgttccctgcgcacggtcggtgcgcttgccgagcacggcgtg
cagcttgagctgacgcccacggacaatgtccggcgttttcttcaggagcggtggggcggg
ctgcgctttgccctatggggcatgcaggcccgtgaaatggaactgagccgtgccatttac
gctactaccctcaacctggatggagccgctcatgagcaggatcgttga

DBGET integrated database retrieval system