KEGG   Devosia sp. Gsoil 520: FPZ08_10345Help
Entry
FPZ08_10345       CDS       T06120                                 

Definition
(GenBank) NAD(P)-dependent alcohol dehydrogenase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
dea  Devosia sp. Gsoil 520
Pathway
dea00040  Pentose and glucuronate interconversions
dea01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dea00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    FPZ08_10345
Enzymes [BR:dea01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     FPZ08_10345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Shikimate_DH 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: QDZ11118
LinkDB All DBs
Position
complement(2108642..2109688)
Genome map
AA seq 348 aa AA seqDB search
MTKARALVLERQHELALRDIDLPLDVGPGMVRIAIHTVGVCGSDVHYYTHGRIGPFVVNA
PMVLGHEAAGTVTAVGEGVTHLSVGDRVCMEPGIPDPNSRASRLGMYNVDPAVQFWATPP
VHGVLTAEVVHPANYTFKLPDNVSFAEGAMVEPFAVGMQAAAKAKIVPGDTALVLGAGPI
GTMVALAALAGGCARVIVADLAQPKLDISAQYQGVIPVNIREKNLVEEVGHLTDGWGVDV
VFECSGSPQAWKTIMDLPRPGGAIVVVGLPVEPTTIDIAGLSVKELRIESVFRYAHQYDR
AIALIASGKVDLKPLISETFAFEDSKAAFDRAVEARPSDVKLQIRVAG
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagcccgcgccctcgttctcgaacgccagcatgaactggccctgcgcgatatc
gacctgccgctcgatgtcgggccgggcatggtcaggattgccatccatacggtgggcgtg
tgcggctcggatgtccactactacacccatggccggatcgggcctttcgtggtcaatgcg
cccatggtgctggggcatgaggcggccggcacggtgaccgcggttggcgaaggggtgacc
catctcagcgtgggtgatcgcgtctgcatggagccgggtattcccgatcccaattcgcgg
gccagccggctgggcatgtataatgttgatccggccgtgcaattctgggccacgccgccg
gtgcatggcgtgctgaccgcagaagtggtgcatccggccaattacaccttcaagctgccc
gacaatgtgagctttgccgaaggcgccatggtggagccctttgccgtgggcatgcaggcg
gccgccaaggcgaagatcgtgcccggcgacaccgctttggtgctcggcgccgggcccatc
ggcaccatggtggcgctggcggctctggccggtggctgcgcgcgggtcatcgtggccgac
ctggcccagcccaagctcgacatatcagcgcagtatcagggggtcatcccggtcaatatc
cgcgaaaagaaccttgtcgaggaggtcggccacctcaccgatggctggggtgtcgatgtg
gtgttcgaatgctcgggctcgccgcaggcctggaagaccatcatggacctgccccgaccc
ggtggcgcgatcgtggtggtcggcctgccggtcgagcccaccacgatcgatattgccgga
ctgtcggtcaaggagctgcgcatcgaaagcgtgttccgctatgcccaccaatatgaccgc
gccatcgccctgatcgcctcgggcaaggtggacctcaagcccctgatttcggaaaccttc
gccttcgaggattcgaaggccgcgttcgaccgagccgtagaagcgcggccgagcgatgtg
aagctgcagatcagggtggcggggtag

DBGET integrated database retrieval system