KEGG   Devosia sp. Gsoil 520: FPZ08_20515Help
Entry
FPZ08_20515       CDS       T06120                                 

Gene name
pcaF
Definition
(GenBank) 3-oxoadipyl-CoA thiolase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
dea  Devosia sp. Gsoil 520
Pathway
dea00071  Fatty acid degradation
dea00280  Valine, leucine and isoleucine degradation
dea00281  Geraniol degradation
dea00362  Benzoate degradation
dea00592  alpha-Linolenic acid metabolism
dea01100  Metabolic pathways
dea01110  Biosynthesis of secondary metabolites
dea01120  Microbial metabolism in diverse environments
dea01130  Biosynthesis of antibiotics
dea01212  Fatty acid metabolism
Module
dea_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:dea00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    FPZ08_20515 (pcaF)
   00592 alpha-Linolenic acid metabolism
    FPZ08_20515 (pcaF)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    FPZ08_20515 (pcaF)
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    FPZ08_20515 (pcaF)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    FPZ08_20515 (pcaF)
   00642 Ethylbenzene degradation
    FPZ08_20515 (pcaF)
Enzymes [BR:dea01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     FPZ08_20515 (pcaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: QDZ12915
LinkDB All DBs
Position
4206828..4208030
Genome map
AA seq 400 aa AA seqDB search
MTEAYICAYKRTPIGRFGGALSAVRPDDLGAIPLKALMAAHAGVDWEAVDDVIFGNANQA
GEDNRNVARMSLLLAGLPVGVPGTTINRLCGSGMDALITAARAIKSGEAELLIAGGTESM
SRAPFVLPKAATAFSRNAEIYDTTIGWRFVNPLMKAQYGVDSMPETGENVAQDFGVSREA
QDAFAVRSQDKAVAAQQNGRLAKEIVPVTISQKKGDAIIVDTDEHPRAGTTVETLTKLRP
LFPNGTVTAGNASGVNDGAAALIIASEAAAKKHGLTPIARILGGATAGVPPRIMGMGPAP
ATKKLCARLGLSPADFDIIELNEAFASQGIAVLRDLGLAEDAAQVNRNGGAIALGHPLGM
SGARIAGTAALELALGGGKLALATMCIGVGQGIAVALERV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacggaagcctatatctgcgcctataagcgcacccctatcggccgtttcggcggcgcg
ctctctgccgtccgccccgacgatctcggcgccatcccgctcaaggcactgatggcagcc
catgccggcgtcgattgggaagccgtcgatgacgtcatcttcggcaatgccaaccaggcc
ggcgaggataacagaaacgtcgcccgcatgagcctgctgctcgccggcctgccggtcggc
gtgcccggcaccaccatcaaccgcctctgcggttcgggcatggacgcgctgatcaccgcc
gcccgcgctatcaagtcgggcgaggccgaactgctcattgctggcggcaccgaaagcatg
tcgcgtgcgcccttcgtgctgcccaaggccgcgaccgccttttcgcgcaatgccgagatt
tacgacaccaccattggctggcgcttcgtcaatccgctgatgaaggcgcaatacggcgtc
gattccatgcccgagaccggcgagaatgtcgcccaggacttcggcgtgagccgcgaagcg
caggacgccttcgccgtgcgcagccaggacaaggccgtggccgcacagcagaacggacgc
ctcgccaaggaaatcgtccccgtcaccatttcgcagaaaaagggcgacgcgatcatcgtc
gataccgacgagcatccgcgcgccggcaccacggtggaaaccctcaccaaactccgcccg
ctcttccccaatggcacggtgaccgccggcaacgcctccggcgtcaatgatggcgccgcg
gcgctgatcatcgccagcgaagccgccgcgaaaaaacacggcctcacccccattgcccgc
atcttgggcggtgccacggctggtgtcccgccgcgcatcatgggcatgggcccggccccc
gcgacgaaaaaactctgcgcccgcctcggcctgtccccggccgatttcgacatcatcgaa
ctcaacgaggccttcgccagccagggcatcgccgtcttgcgtgatctcggccttgccgaa
gacgcagcgcaggtaaaccgcaatggcggcgccatcgcgctcggtcatcccctcggcatg
agcggcgcccgcatcgccggcacggcggcgctggaactggctctgggcggcggcaagctg
gcgctggccaccatgtgcatcggcgtcggccagggcatcgctgtcgcgctcgaacgggtc
tag

DBGET integrated database retrieval system