KEGG   Dehalococcoides mccartyi BAV1: DehaBAV1_0770Help
Entry
DehaBAV1_0770     CDS       T00518                                 

Definition
(GenBank) ABC transporter related protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
deb  Dehalococcoides mccartyi BAV1
Brite
KEGG Orthology (KO) [BR:deb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:deb02000]
    DehaBAV1_0770
Transporters [BR:deb02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    DehaBAV1_0770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran DUF4162 AAA_21 AAA_15 AAA_22 SMC_N AAA_16 AAA_30 SRP54 AAA_19 TrwB_AAD_bind AAA_23 PhoH AAA_29 AAA_24 AAA_27 ATP-synt_ab AAA
Motif
Other DBs
NCBI-ProteinID: ABQ17353
LinkDB All DBs
Position
758578..759474
Genome map
AA seq 298 aa AA seqDB search
MYVVETHGISKIYGRNVIVDNLSLSLEQGQIMGLIGPNGAGKTTTLRMMMDIIKPDSGKV
LILGEQMNADAQNHIGYLPEERGLYRKQKIIDSLVYLASLKGMNPVVARTRAMELLEKVG
LSAHAEKKVEQLSHGMGQLVQLVSTIIHDPVLMIIDEPFNGLDPVNVQLVKDLMLELRSQ
NKSLILSTHRMNEVEEMCDRICMLNKGQQVLYGNLLDIKNRYRSNTLEVDYEGEFPPLSN
VSDTKAANGKAHIILNGSTTAQDVLVQLVKSGLVIHRFEIATPTLNDIFISIAGKKNV
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgtacgtagtagaaacacacggcatatccaaaatatatggacgcaacgttattgtagat
aatctatcccttagccttgagcaagggcagattatggggttgattggacctaacggggca
ggcaaaactacaactctgcgcatgatgatggatattatcaagcctgacagcgggaaagtg
cttatactgggtgagcaaatgaatgctgatgcccagaaccatatcggttatctgcctgaa
gaacggggtctttaccgcaaacagaaaatcatagattctctggtatatctggccagtctt
aaaggcatgaaccctgtcgttgccagaaccagagctatggagttattggaaaaagtgggt
ctttcagcccatgccgaaaaaaaggtggaacagctttcgcatggcatggggcaactggta
cagctggtctccaccattatccatgacccagttctaatgataatagacgagccttttaac
gggctggatccggtaaatgtccaactggtaaaagacctgatgctggaactgcgtagccaa
aacaaatcacttatcctttctactcaccgcatgaatgaagtagaggaaatgtgtgaccgt
atttgcatgcttaacaaaggccagcaggtgctgtatggcaatctgcttgatattaaaaac
cgctatcgcagcaatacgcttgaggtagattatgaaggcgagtttcctcccctatctaac
gtcagtgataccaaagcggcaaacggcaaagcccatattatattaaacgggagcactact
gcccaagatgtgctggtgcaactggttaaaagcgggctggttatacaccgctttgaaata
gctacccctactttaaatgatatttttatcagcattgcaggtaagaaaaatgtctaa

DBGET integrated database retrieval system