KEGG   Dehalococcoides mccartyi BAV1: DehaBAV1_0840Help
Entry
DehaBAV1_0840     CDS       T00518                                 

Definition
(GenBank) manganese and iron superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
deb  Dehalococcoides mccartyi BAV1
Brite
Enzymes [BR:deb01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     DehaBAV1_0840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ABQ17423
LinkDB All DBs
Position
826914..827492
Genome map
AA seq 192 aa AA seqDB search
MYTARDYSALTGIEGFSDTLLKNHFTLYQGYVNNTNKLADTLKAMLAEGKTATPEYAELK
RRFGFEFDGMRLHEYYFSNLGKSVPLSETGKFYQALAAEFGSYQLWEADFKATSAMRGIG
WVILYKDPQTGRLFNQWINEHEAGHLAGATPILVIDVFEHAFLTDYGLKRAEYIAAFIKN
INWSEVEKRFLI
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgtacactgcacgtgactattctgccctgactggtattgaagggttttctgataccctg
cttaaaaaccattttactttataccaaggttatgtaaacaacaccaacaaacttgcggat
actttaaaggccatgcttgcggaaggtaaaacagctacgccggaatatgctgagctcaaa
cgccgtttcgggtttgaatttgacggtatgcgtttgcacgaatactatttttctaacctt
ggaaaatctgtacccctatcagaaacgggcaaattctaccaggcactggcagcagaattc
ggtagttaccagctctgggaagcagactttaaagctacctccgctatgcggggcataggc
tgggtaatactctataaagaccctcagaccggacgcctgtttaaccagtggataaacgag
catgaagccgggcatctggcaggtgccaccccgatactggtaatagacgtatttgaacat
gccttcctgacagattacgggctgaaacgagcagaatacattgctgcctttataaaaaat
ataaactggtctgaggtggaaaaacgtttcctgatataa

DBGET integrated database retrieval system