KEGG   Dehalobacter sp. CF: DCF50_p1424Help
Entry
DCF50_p1424       CDS       T02279                                 

Definition
(GenBank) Phosphoribosyl-AMP cyclohydrolase / Phosphoribosyl-ATP pyrophosphatase
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
dec  Dehalobacter sp. CF
Pathway
dec00340  Histidine metabolism
dec01100  Metabolic pathways
dec01110  Biosynthesis of secondary metabolites
dec01230  Biosynthesis of amino acids
Module
dec_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:dec00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    DCF50_p1424
Enzymes [BR:dec01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     DCF50_p1424
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     DCF50_p1424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: AFV05430
UniProt: K4L1K1
LinkDB All DBs
Position
complement(1461068..1461748)
Genome map
AA seq 226 aa AA seqDB search
MNSRFESGSIDISKAVQAVKWDEKGLVPAIAQDAESGEVLMLAYMNQEALKKTLTEGKAC
YFSRSRNQLWVKGETSGHYQEVIDIRFDCDRDTILLKVKQSGMACHENYYSCFHYLPGSE
TCCGEPGTKPPVSLGRTLEMLAEVIKQRNIERPEGAYTTYLFTKGIDKILKKVGEECAEV
IIAAKNDSLSEIRYEASDLLYHLLVMLEDRNVPLSEIAEELNSRRK
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtagatttgagtcagggagcatcgatatttccaaagccgtacaggctgtgaag
tgggatgaaaaaggtcttgttccggccattgcccaggatgctgaaagcggtgaagtactg
atgctcgcctacatgaatcaggaagcgctgaaaaaaaccctgactgaaggcaaagcgtgt
tatttcagccgcagcagaaatcagctctgggtcaagggggagacatcaggtcattaccag
gaagtgattgatatccggtttgactgtgaccgggatacgattcttctgaaggtgaaacaa
agtggaatggcctgtcatgaaaactattactcctgttttcactatctgccaggctctgaa
acgtgctgcggcgaaccgggtaccaaacctcctgtctctttgggcaggactttggaaatg
ctcgccgaagttatcaagcagagaaatatcgagaggccggaaggtgcctatacaacctat
ctctttaccaaagggatcgacaagatcctaaaaaaagtcggggaggagtgcgcggaagtt
atcattgccgccaaaaacgattcgttgagtgagatccgttatgaagcttccgatctgttg
taccacctgcttgtcatgctggaagacagaaacgtacctctatctgagattgccgaagag
ctcaattcaagaagaaaataa

DBGET integrated database retrieval system