KEGG   Dehalobacter sp. CF: DCF50_p1819Help
Entry
DCF50_p1819       CDS       T02279                                 

Definition
(GenBank) DNA primase/helicase
  KO
K17680  twinkle protein [EC:3.6.4.12]
Organism
dec  Dehalobacter sp. CF
Brite
KEGG Orthology (KO) [BR:dec00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dec03029]
    DCF50_p1819
Enzymes [BR:dec01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     DCF50_p1819
Mitochondrial biogenesis [BR:dec03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Mitochondrial DNA maintenance factors
    DCF50_p1819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DnaB_C AAA_25 zf-CHC2 Toprim_4 Toprim_2 Toprim_3 ATPase_2 ABC_tran AAA_24 AAA_22 RNA_helicase SMC_N DAP3 Toprim AAA_23 ATPase AAA_29 SRP54 AAA_19
Motif
Other DBs
NCBI-ProteinID: AFV05821
UniProt: K4L5E5
LinkDB All DBs
Position
complement(1855347..1857170)
Genome map
AA seq 607 aa AA seqDB search
MDSTELKESLGQRARDIILSGLNIKPNKTELILCPLHPDKNPSMSWFKDGLMWRCHACGG
KIDIYDYLTKFENLSFIEAKERVADMIGFTLEPNRATKKQYILPQIKMRELSKAAIDLMA
VRKITKQTLDAWRVKESTWNGVNVYVFQYFQDNTLKHVTYREIKQGGLKGGCEKNTEPIL
WGMWHVEDGKPLVITEGQPDAMAIWQSGYKNVASVPSGANSLTWIDTCWDWLKGREVILW
ADNDKAGINMADNISRRLDNVKVVHAEDLKDANEVLYKYGPEKVLEIIESASKQIPNGLL
DLSHVEYKIANESGIETGFFEYDSHVEDWKEGELTIVFGRNGEGKTTFISQIIAHCLEKK
VKTFLYSGEMSEFKIQDWLYKQIVGNKQAHMQETQAKYRIKREIKPEIVKQIKQWHEGIL
YLFDRKEEKIAKDLDKFFELMALAAKRYGVKLFIIDNLMSKLEENADSLYSDQANFVQRC
KDFAGNGRAHVVLVAHPNKEKCEIKKDEGNLTKTDISGSNNIPNKADNIIAVERVWSPDR
ECDAIITSLKDRESGERKAFKYNFSPRTLRFYNNCTREEVIYGWENREKYEWGTEVQIPC
PWDEVET
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atggacagtacagaactcaaggaatcattagggcaacgagccagagatattattttatcg
ggattaaatattaagccaaacaaaacggaattgatcctgtgcccgctacatcccgataag
aacccctctatgtcatggtttaaagacggtctaatgtggaggtgccatgcttgcggcgga
aagatcgatatttacgattacctaacgaagttcgaaaatttaagtttcatcgaagcaaaa
gagagggttgccgacatgataggctttaccctagagcctaaccgagccactaaaaagcaa
tacattcttccgcaaattaagatgcgggaattatcaaaagcagcgattgacttgatggcg
gtccgtaagataacgaaacaaaccttggatgcatggagagttaaggaatcaacctggaac
ggcgtcaatgtatatgtttttcagtattttcaagataacaccctgaagcatgtgacatat
cgggaaataaagcagggcggattaaaaggcggttgtgaaaagaataccgagccaattctc
tgggggatgtggcatgtggaagatggtaagcccttagtgattacagagggccagccggac
gcaatggcaatctggcaaagtggatacaaaaacgtggcaagcgtccccagtggagcgaat
agcctgacatggattgacacttgctgggactggctgaaaggtcgagaggtcatcttatgg
gccgataatgacaaagctggaataaacatggccgataacatttcccgcaggctcgacaat
gtgaaagtagttcacgccgaagacctgaaagatgctaatgaagtcctttacaaatacgga
cctgaaaaggttttggaaatcattgaaagcgcatcaaagcaaataccgaacggtctcttg
gatttatctcatgtcgaatacaaaatagccaacgaatcagggattgagacaggttttttt
gaatatgacagccatgtcgaggactggaaggaaggagaattgactatagttttcggcagg
aacggagagggaaaaacgacttttataagtcagattatcgctcactgccttgagaagaaa
gtcaaaaccttcttgtattccggggaaatgtcagaatttaaaattcaggactggctttat
aaacaaatagttggcaacaaacaagcccatatgcaagagactcaggcaaagtacaggata
aagagggaaataaagccggaaatagtcaagcaaattaaacaatggcatgaagggatactt
tatctattcgatcggaaggaagagaaaattgctaaagacctggataaattctttgagttg
atggctctagctgccaaacgctacggagtgaaactttttatcattgataacctgatgtcg
aagctggaagagaatgcagacagcctttattcagaccaagctaattttgtccaacgctgt
aaagactttgccggcaacggcagggctcatgtagttctcgtagctcacccgaacaaggaa
aagtgcgagatcaaaaaggacgaagggaaccttactaaaaccgatatttccggcagtaac
aacatccctaataaggccgataatatcatagcggttgagagggtatggagcccggataga
gaatgtgacgcgatcattaccagcctgaaagaccgtgaatctggagaaagaaaagctttt
aagtataatttcagtccaagaacattgagattttataacaactgcaccagggaggaagta
atttacggttgggaaaaccgtgagaaatacgaatggggaaccgaagtacaaataccttgc
ccttgggatgaggtggaaacatga

DBGET integrated database retrieval system