KEGG   Dehalobacter sp. CF: DCF50_p2127Help
Entry
DCF50_p2127       CDS       T02279                                 

Definition
(GenBank) ATP-dependent DNA ligase clustered with Ku protein, LigD
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
dec  Dehalobacter sp. CF
Pathway
dec03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:dec00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    DCF50_p2127
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dec03400]
    DCF50_p2127
Enzymes [BR:dec01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     DCF50_p2127
DNA repair and recombination proteins [BR:dec03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     DCF50_p2127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFV06130
UniProt: K4L3M4
LinkDB All DBs
Position
2180231..2181148
Genome map
AA seq 305 aa AA seqDB search
MNLEFDGKTLNITNPEKLLWPDLGIRKLDYLKILLELAPYLLPHVQDRLLTTIRYPDGFQ
GKSFFQKNIPDYAPGWIPTIEWRDNQYIILESEAILIWLGNQACLEFHIPFNPYDRDQYP
SALVFDLDPSEGQTFEDVTEAALLIFEELKALQITSYIKTSGASGLQIHIPTGGKYDYNT
ARKINEFFAVYFSQKYPRQITLERSVAKRGHKLYFDYLQMWQGKTIISPYSPRATAYASV
AAPLEWQELRHGVKPQDFNLLNISGRLKDKGDLFAPLLNKKNGQDRKNSQDLDFILERIV
AHRQP
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaacctggaattcgacggcaaaacgctcaatataaccaaccctgaaaaattattatgg
cctgaccttggtatccgcaagcttgattatttgaaaatcctgctggaattagccccgtac
cttctgcctcacgtccaagaccgtctactgacgacgatccgttatcctgatggtttccag
ggcaagtccttcttccagaaaaatatccctgattatgcccctgggtggattccgacgatc
gaatggcgggataatcagtatatcattttagaatcagaagcaatcctcatttggctcgga
aaccaggcgtgtctggaattccacattccatttaacccatatgacagggatcagtatcct
tctgcactggttttcgatctggacccttccgaaggtcagacctttgaggatgtcacggaa
gcggccctgctgatttttgaagagcttaaagcgcttcagattacaagctatatcaaaact
tccggggcaagcggacttcagatccatattccgacaggcgggaagtatgattacaatact
gccagaaaaatcaacgaattttttgcggtttatttcagccagaaataccctcggcaaatt
accctggagcgcagtgtcgccaaaagaggccataagctctattttgactatctgcagatg
tggcagggcaaaaccatcatcagtccatattcaccaagagcaacagcctacgcctccgtt
gccgctccgctggaatggcaagagctgcggcacggggtcaaaccccaggattttaatctg
ctgaatatcagcggcaggctgaaggataaaggggatcttttcgctccgctgcttaataaa
aaaaatggacaagacaggaagaatagccaggatctcgattttatccttgaacggattgtg
gcccacagacaaccctag

DBGET integrated database retrieval system