KEGG   Dehalobacter sp. DCA: DHBDCA_p1415Help
Entry
DHBDCA_p1415      CDS       T02278                                 

Definition
(GenBank) Imidazole glycerol phosphate synthase amidotransferase subunit
  KO
K02501  imidazole glycerol-phosphate synthase subunit HisH [EC:4.3.2.10]
Organism
ded  Dehalobacter sp. DCA
Pathway
ded00340  Histidine metabolism
ded01100  Metabolic pathways
ded01110  Biosynthesis of secondary metabolites
ded01230  Biosynthesis of amino acids
Module
ded_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:ded00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    DHBDCA_p1415
Enzymes [BR:ded01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.10  imidazole glycerol-phosphate synthase
     DHBDCA_p1415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase GATase_3 SNO Peptidase_C26 GATase_5 DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: AFV02444
LinkDB All DBs
Position
complement(1431996..1432607)
Genome map
AA seq 203 aa AA seqDB search
MIGIVDYGRGNLRSVEKAFEKLGFSAEIMESPERLTGMDGVILPGVGAFADAMDALAKGG
WLDPLKQYVQSGKPFLGICLGMQLLFEIGEEHGEHAGLGFLKGRVVKFPPGLKIPHMGWN
TLNVVRPNRLCEDIPNHSYFYFVHSYFAQPADRDCIAGTSEYGLEFPALVGKDNVWGAQF
HPEKSSPWGLIMLDNFGKWVKNQ
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgataggcatagtagactatggacgcggaaatctgcgcagtgtagaaaaggcgtttgaa
aaacttgggttttcagcggagatcatggagtctccggagaggctgaccggtatggacgga
gttattctgcccggcgtcggcgcttttgctgacgctatggatgcgctggccaaaggcggt
tggcttgaccctttaaaacagtatgtacaaagcggcaaaccttttctgggcatctgcctc
ggtatgcagctgctttttgagattggcgaggaacatggagaacatgccggtcttggtttt
ctgaaaggccgggtggtcaaatttccgccgggtctaaagattccgcatatgggctggaat
acgctgaatgttgtcagaccgaacaggctctgtgaggatattccgaaccattcttatttt
tattttgtccactcttatttcgctcagccagccgatcgggactgtattgccggaaccagc
gagtatggactggagttccctgcgctggtcggcaaagacaatgtctggggtgcgcagttc
cacccagagaagtccagcccctggggtctgatcatgctcgataattttgggaaatgggtg
aaaaatcaatga

DBGET integrated database retrieval system