KEGG   Dehalobacter sp. DCA: DHBDCA_p2113Help
Entry
DHBDCA_p2113      CDS       T02278                                 

Definition
(GenBank) ATP-dependent DNA ligase clustered with Ku protein, LigD
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
ded  Dehalobacter sp. DCA
Pathway
ded03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ded00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    DHBDCA_p2113
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ded03400]
    DHBDCA_p2113
Enzymes [BR:ded01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     DHBDCA_p2113
DNA repair and recombination proteins [BR:ded03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     DHBDCA_p2113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFV03140
LinkDB All DBs
Position
2150443..2151360
Genome map
AA seq 305 aa AA seqDB search
MNLEFDGKTLNITNPEKLLWPDLGIRKLDYLKILLELAPYLLPHVQDRLLTTIRYPDGFQ
GKSFFQKNIPDYAPGWIPTIEWRDNQYIILESEAILIWLGNQACLEFHIPFNPYDRDQYP
SALVFDLDPSEGQTFEDVTEAALLIFEELKALQITSYIKTSGASGLQIHIPTGGKYDYNT
ARKINEFFAVYFSQKYPRQITLERSVAKRGHKLYFDYLQMWQGKTIISPYSPRATAYASV
AAPLEWQELRHGVKPQDFNLLNISGRLKDKGDLFAPLLNKKNGQDRKNSQDLDFILERIV
AHRQP
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaacctggaattcgacggcaaaacgctcaatataaccaaccctgaaaaattattatgg
cctgaccttggtatccgcaagcttgattatttgaaaatcctgctggaattagccccgtac
cttctgcctcacgtccaagaccgtctactgacgacgatccgttatcctgatggtttccag
ggcaagtccttcttccagaaaaatatccctgattatgcccctgggtggattccgacgatc
gaatggcgggataatcagtatatcattttagaatcagaagcaatcctcatttggctcgga
aaccaggcgtgtctggaattccacattccatttaacccatatgacagggatcagtatcct
tctgcactggttttcgatctggacccttccgaaggtcagacctttgaggatgtcacggaa
gcggccctgctgatttttgaagagcttaaagcgcttcagattacaagctatatcaaaact
tccggggcaagcggacttcagatccatattccgacaggcgggaagtatgattacaatact
gccagaaaaatcaacgaattttttgcggtttatttcagccagaaataccctcggcaaatt
accctggagcgcagtgtcgccaaaagaggccataagctctattttgactatctgcagatg
tggcagggcaaaaccatcatcagtccatattcaccaagagcaacagcctacgcctccgtt
gccgctccgctggaatggcaagagctgcggcacggggtcaaaccccaggattttaatctg
ctgaatatcagcggcaggctgaaggataaaggggatcttttcgctccgctgcttaataaa
aaaaatggacaagacaggaagaatagccaggatctcgattttatccttgaacggattgtg
gcccacagacaaccctag

DBGET integrated database retrieval system