KEGG   Desulfovibrio sp. G11: CNY67_05370Help
Entry
CNY67_05370       CDS       T05183                                 

Gene name
glpA
Definition
(GenBank) anaerobic glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
def  Desulfovibrio sp. G11
Pathway
def00564  Glycerophospholipid metabolism
def01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:def00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CNY67_05370 (glpA)
Enzymes [BR:def01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CNY67_05370 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 Pyr_redox_2 DAO_C FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ATD80898
LinkDB All DBs
Position
1196223..1197830
Genome map
AA seq 535 aa AA seqDB search
MLETTVVVIGGGATGIGALRDLCMRGIPAILLEQGGIAHGTSSRFHGLLHSGARYVVNDN
ESARECIEENMIVRRIGRQCVEETEGFFALTPQDDPAYVEKFVAGCREAGIDAQEIEVAE
ALRLEPNLSPEVRRVFRVPDSCVDGFRLVLHNAMSARRHGGRMLTYHEATAITLRNGRVC
GVTAVDRHTGATVEIACQCVINAAGSWAGRIAGMAGLDVALSPDRGTLVVFNHRFTSRVI
NRLHPSGDGDIFVPHGSITILGTTSASTDRPDDTTPTTEEVLRLLDIGEPLFPQVRQYRI
LRAFAGTRPLYTPGGAAGRKASRNFHIVDHADEGLEGMVSIFGGKLTTYRLMAERVVDRV
CAKLGHSAVCRTATEALVPDADEATLKRAARFFPMQGLNLMADRLGDDLPSVLELAEQQA
GNPLICECEMVSLAEIEYVARQPATFSLTDIRLRTRLGMGTCQGAFCSLRTVGALAEHGV
QLELTPTDNVRRFLQERWGGLRFALWGMQAREMELSRAIYATTLNLDGAAHEQDR
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgctggaaacaaccgttgtagtcattggaggcggcgcgaccggtattggtgcgctgcga
gacctgtgcatgcggggaattcccgccattctgcttgagcaggggggcatcgcccacggc
accagctcacgctttcatggtctgctgcacagcggagcgcgctatgtcgtcaatgacaat
gaatccgcccgggaatgtattgaggaaaatatgatcgtgcgtcgtatcggcagacaatgc
gttgaggaaaccgaagggttcttcgcgcttacgccgcaggacgaccccgcatatgttgaa
aaatttgtggctggctgtcgcgaggcaggcattgacgcgcaagaaattgaagttgccgag
gccttgcggctggagccgaatctttcgcctgaggtccgccgggtttttcgtgtgcccgat
tcctgtgtagacggttttcgcctggtgctgcataacgccatgtcggcccggcgccatggc
gggcgcatgctcacctatcatgaggccaccgccataacgctgcgcaatggccgtgtatgc
ggtgtcacagccgttgatcgccataccggggcaacagttgaaatcgcctgtcagtgcgtc
atcaatgcggccggctcgtgggccgggcgcatcgcgggcatggcgggccttgatgtggcg
ctttcgcccgacaggggaacgctggtggttttcaaccaccgttttacctccagagtcatc
aaccgtctgcatcccagtggcgacggggatatttttgtgccgcatggttccatcaccatt
ctcggcaccacatccgcgtccaccgacagaccggacgacaccacgcctacaactgaagag
gtgctgcgtctgcttgatatcggcgaaccgctttttccccaggtgcgccagtaccgcatt
ctgcgtgcctttgccggcacacgcccgttgtataccccgggcggagcggcagggcgcaag
gccagccgtaattttcatattgtggatcatgcggatgagggccttgagggcatggtcagt
attttcggtggcaaacttaccacctaccgtcttatggctgagcgggttgttgacagggtt
tgcgccaagctggggcatagtgctgtctgccgcacggctacagaagcccttgtgccggac
gcggacgaagctacgctcaaacgggcggcccgcttttttcccatgcagggcctgaatctc
atggccgaccggcttggtgatgaccttccgtcagtgctggaactggccgaacagcaggcg
ggcaatccgctgatctgcgaatgcgaaatggtgagcctggctgaaattgaatatgtggcg
cgccagcctgccacattttctcttactgacatacgcttgcgtacgcgccttggcatggga
acctgccagggagcgttttgttccctgcgcacggtcggtgcgcttgccgagcacggcgtg
cagcttgagctgacgcccacggacaatgtccggcgttttcttcaggagcggtggggcggg
ctgcgctttgccctatggggcatgcaggcccgtgaaatggaactgagccgtgccatttac
gctactaccctcaacctggatggagccgctcatgagcaggatcgttga

DBGET integrated database retrieval system