KEGG   Desulfovibrio sp. G11: CNY67_13575Help
Entry
CNY67_13575       CDS       T05183                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
def  Desulfovibrio sp. G11
Pathway
def00550  Peptidoglycan biosynthesis
def01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:def00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CNY67_13575
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:def01002]
    CNY67_13575
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:def01011]
    CNY67_13575
Enzymes [BR:def01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CNY67_13575
Peptidases [BR:def01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   CNY67_13575
Peptidoglycan biosynthesis and degradation proteins [BR:def01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   CNY67_13575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 Beta-lactamase2 Beta-lactamase Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: ATD82298
LinkDB All DBs
Position
2983796..2984917
Genome map
AA seq 373 aa AA seqDB search
MPSRYRHKRFSFLNVFAYPFLFLLLACLLRPGPGQAAPPIPEHGFLETSSAILYDLDHDA
ILFEQNADQRIAPASLTKVLSMFLALDSVDQGKLSLDNTVTVSRAAAGTGGSRMGLREND
VVSLEQLLMGMAVSSGNDASMAVAECVGGSTPAFVAMMNAKAQALGMRDSQFRNPHGLPA
KGQYTTARDMLTLARAYLQAHPQALRFHNTHTISHKGRVTWNKNPLLGQYPGADGLKTGW
VNASGYNLIFTASQGPRRLLAVILGAPDSRTRGVEAFRLLDAGFQVCGNNAASVVAALDC
LPPERYNPDMRKTAREARRMYAGSDAAPRKNVSKAPQAKQTAKAKPKKKEAHKAARQKRD
SGQAARSGSGRAG
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgcccagccgttaccgccacaagaggttcagcttcctcaatgtgtttgcgtatcctttc
ctgtttttgctgctggcctgcctgctgcgtcccggccccggacaggccgccccccccatt
ccggaacacggttttctggaaaccagttccgccattctgtacgatctggaccacgatgcc
attctttttgagcaaaacgccgaccagcgcattgccccggcatcactgaccaaggtcctt
tcaatgtttctggccctggacagcgtggatcagggcaagctgagcctggacaataccgta
acggtcagccgtgccgccgcaggaaccggcggttcacgcatgggcctgcgggaaaatgac
gtggtgagccttgaacagctgctcatgggcatggctgtgtcttcgggcaatgatgccagc
atggctgtggcggaatgtgtgggcggttcgactccggcttttgtagccatgatgaatgcc
aaagcgcaggccctgggcatgcgcgacagccagttccgcaatccccacgggttgcccgcc
aaaggccagtacaccacggcccgcgacatgctcaccctggcacgggcctatctgcaggcc
catccccaggccctgcgttttcacaacacccacaccatcagccataaagggcgcgtcacc
tggaacaagaaccccctgctgggccagtaccccggcgcggacgggcttaaaacaggctgg
gtcaacgcctcgggctacaatcttatcttcacggccagccaggggcccagacgcctgctg
gccgtcattctgggcgcgcccgactcgcgcacgcgcggggttgaggcgtttcgcctgctg
gatgccggatttcaggtatgcggcaacaatgccgcatcggtggtggcagccctggattgc
ctgcccccggaacgctataaccccgacatgcgcaagacagcccgcgaggcccggcgtatg
tatgcaggcagcgatgccgcacctcgcaaaaacgtgagcaaggcccctcaggccaagcag
acggcaaaagcaaagcccaaaaagaaagaggcccacaaggccgcgcgacaaaagcgcgat
tccggccaggcagccagatccggctctggacgggcgggctag

DBGET integrated database retrieval system