KEGG   Dehalococcoides mccartyi GT: DehalGT_0564Help
Entry
DehalGT_0564      CDS       T01182                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
deg  Dehalococcoides mccartyi GT
Pathway
deg00550  Peptidoglycan biosynthesis
deg01100  Metabolic pathways
deg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:deg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DehalGT_0564
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DehalGT_0564
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    DehalGT_0564
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:deg01011]
    DehalGT_0564
Enzymes [BR:deg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     DehalGT_0564
Peptidoglycan biosynthesis and degradation proteins [BR:deg01011]
 Precursor biosynthesis
  Amino acid ligase
   DehalGT_0564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C CPSase_L_D2 GARS_A ATP-grasp_3 ATP-grasp_4 ATPgrasp_Ter RimK TTL
Motif
Other DBs
NCBI-ProteinID: ADC73931
LinkDB All DBs
Position
530722..531738
Genome map
AA seq 338 aa AA seqDB search
MRIGLSYDLKLALTPVTGGPDDALEEYDSPETVEAITNALTAAGHAVYRLGGGKEFLRKV
QEHKLDLVFNISEGLGNYRSREAQIPGVLEMLDIPYTGSDPQTLAICLDKPLTKKLVAGA
GVKTAKWQLVSNCEELSTIDWSDFPLPAFLKPACEGSSKGVRFASRAESTDEIMRMATEL
LTTYNQPVLVEEFINGDEITVGVIGNDKPKVLGIMRIVPKTKADYFVYSIEIKRNWRQMV
EYEVPAALPAKTLAHIEKATLDAYRVLECHDLCRMDFRVSPDGTPYFLEVNPLPGLNPVS
GDLPIMASKLGISHADLVLEILNTAIARHNLVTADCLA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatagggttgtcatacgatcttaaactggctttgaccccggtaaccggcggccct
gatgatgcgttggaggaatatgactcaccggaaacggtggaggctataacaaacgcctta
acagcggctggacatgctgtttaccgtttgggcgggggtaaagaatttttacgcaaggta
caggaacataaactggatcttgttttcaatatttcagagggtttgggtaactaccgcagc
cgcgaagctcaaattcccggtgttttagagatgttagatataccttacaccggttcagac
ccgcagacactggcaatctgtctggataaaccactaaccaagaaattggtggctggtgcg
ggcgtaaagactgccaaatggcagttggttagcaactgtgaagagctttcaaccatagac
tggtcggatttccctttgccggctttcctgaaaccagcctgcgagggttcaagcaagggt
gtgcggtttgcttctcgggcggaaagtaccgacgagataatgaggatggctacagaactt
ttaactacctataaccaacctgttttggtagaggaatttataaatggcgacgaaattacg
gtaggtgttatagggaacgataagcctaaagttctgggtataatgcggattgtgcctaaa
accaaagccgattattttgtgtattccattgagataaaacgcaactggcggcagatggta
gagtatgaagtaccggcggccttacctgccaaaactttggcccatattgaaaaagccaca
ctggatgcgtatagagtactggaatgccatgatctatgccggatggattttagggtaagc
ccggatggtacgccgtattttctggaggttaacccgcttcccggtcttaaccctgtcagc
ggagatttacctattatggcatctaaattaggtatcagccacgcagatttggtgttagaa
atacttaacactgccattgcccgccacaatttggtaacggcagactgtttggcctga

DBGET integrated database retrieval system